DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30339 and F18A11.2

DIOPT Version :9

Sequence 1:NP_724813.1 Gene:CG30339 / 246549 FlyBaseID:FBgn0050339 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_496771.1 Gene:F18A11.2 / 174945 WormBaseID:WBGene00008929 Length:388 Species:Caenorhabditis elegans


Alignment Length:320 Identity:56/320 - (17%)
Similarity:107/320 - (33%) Gaps:98/320 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ETELNEVEERVPADLKALRDWLAKQPHLRARQDDQFLVGFLRGCKFSLEKTKSKLDHFYTIKTLM 80
            |.|.:|:.:.||.|       :..|.|    |||.                          |.||
 Worm    70 ELEEDELNKYVPID-------VIGQNH----QDDN--------------------------KVLM 97

  Fly    81 PELFGK----RLVDERNLILCRSGTYVRLPKPWGTDGPRLQLTNYEKFDPKEFKLLDLFRYQTMI 141
            .|..||    .|||  |:::                         .||...:.|:::....:.:.
 Worm    98 FERTGKIDISGLVD--NVLM-------------------------HKFMQIKLKMMEGVHQKVVA 135

  Fly   142 TEQSIREDDHSNISGYVEIVDMAKMSLS--FLAQLDFTLIKRMGIFAEKAQPTRLKGVHLINCPK 204
            .|:.....     ||.:.|:|:..:|.|  .::.|........|...:. .|..|:.:.::|.|.
 Worm   136 AERKTGRQ-----SGGLFIMDLDGISFSPKLISVLTGPYRIMWGTLFDH-YPQLLQKIIIVNAPS 194

  Fly   205 EGVALLNLAKSLMPSKLQQRFHVYKN--LEQLNEVIPREYLPEEYGGNNGRIADI---------- 257
            ....|.......:|...:::..:...  :..:.:...:.:||.:.||:..:...:          
 Worm   195 FVNVLHQACSPFLPEDYKEKIVITSEPAIGAIQKHADKCFLPSDLGGDLEKTTSLPMAPFPKMNK 259

  Fly   258 QAEAEKKLLSYESYFAEDSQYGVDE-QLRPGKRV-----NADS----IFGAEGSFRKLDI 307
            :.|.||:.:|..:......:|.|.: ..:.|..|     |..|    :|.:|...:.:|:
 Worm   260 KYEKEKEKVSLLAISVPAGKYTVQKFSWKKGDEVEFFLHNESSFHYFMFHSEEDTKDMDL 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30339NP_724813.1 CRAL_TRIO_N 28..70 CDD:215024 6/41 (15%)
CRAL_TRIO 109..250 CDD:279044 21/144 (15%)
F18A11.2NP_496771.1 SEC14 72..244 CDD:214706 42/241 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.