DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30339 and CLVS2

DIOPT Version :9

Sequence 1:NP_724813.1 Gene:CG30339 / 246549 FlyBaseID:FBgn0050339 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001010852.2 Gene:CLVS2 / 134829 HGNCID:23046 Length:327 Species:Homo sapiens


Alignment Length:309 Identity:78/309 - (25%)
Similarity:141/309 - (45%) Gaps:47/309 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSAELRRIAETELNEVEERVPADLKALRDWLAKQPHLR-ARQDDQFLVGFLRGCKFSLEKTKSKL 70
            ||.|....|..||||..:.:..|::.:||.:..:|.:. .|.||.|::.|||..||         
Human     8 LSPETLEKARLELNENPDTLHQDIQEVRDMVITRPDIGFLRTDDAFILRFLRARKF--------- 63

  Fly    71 DHFYTIKTLMPELFGKRLVDERNLILCRS------GTYVRLPKPWGTDGPRLQLTNYEK------ 123
             |.:....|:.:.|..|   ::||.:.:|      |....|..  |..|....|.:|.:      
Human    64 -HHFEAFRLLAQYFEYR---QQNLDMFKSFKATDPGIKQALKD--GFPGGLANLDHYGRKILVLF 122

  Fly   124 ---FDPKEFKLLDLFRYQTMITEQSIREDDHSNISGYVEIVDMAKMSLSFLAQLDFTLIKRMGIF 185
               :|...:.|:|:.| ..:::.:::.||....::|:|.|:|.:..:....::|..::::.....
Human   123 AANWDQSRYTLVDILR-AILLSLEAMIEDPELQVNGFVLIIDWSNFTFKQASKLTPSMLRLAIEG 186

  Fly   186 AEKAQPTRLKGVHLINCPKEGVALLNLAKSLMPSKLQQRFHVY-KNLEQLNEVIPREYLPEEYGG 249
            .:.:.|.|..|:|.:|.|....||..:.:..:..|.::|..:: .||..|:::|..|.||.|:||
Human   187 LQDSFPARFGGIHFVNQPWYIHALYTVIRPFLKEKTRKRIFLHGNNLNSLHQLIHPEILPSEFGG 251

  Fly   250 -----NNGRIADIQAEAEKKLLSYESYFAEDSQYGVDEQLRPGKRVNAD 293
                 :.|..|       :.||.:|  :.:||:|.||....|.|.|..:
Human   252 MLPPYDMGTWA-------RTLLDHE--YDDDSEYNVDSYSMPVKEVEKE 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30339NP_724813.1 CRAL_TRIO_N 28..70 CDD:215024 13/42 (31%)
CRAL_TRIO 109..250 CDD:279044 35/155 (23%)
CLVS2NP_001010852.2 CRAL_TRIO_N 29..75 CDD:215024 15/55 (27%)
SEC14 106..251 CDD:238099 32/145 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 287..327 1/5 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145901
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.