DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30338 and Rwdd3

DIOPT Version :9

Sequence 1:NP_724811.1 Gene:CG30338 / 246548 FlyBaseID:FBgn0050338 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001121624.1 Gene:Rwdd3 / 65026 RGDID:620472 Length:267 Species:Rattus norvegicus


Alignment Length:237 Identity:59/237 - (24%)
Similarity:106/237 - (44%) Gaps:42/237 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 EELELLSSIYCAPGELHMLDAGVVADFNEFLKDDKTKPATSLLSHLEYVVKLTLPGKQCVEVRVE 82
            :||..|::|:|.|.|..||..            .:|..|.       :.:..|..|....:|.:|
  Rat     7 QELSALAAIFCGPHEWEMLSC------------SETDGAV-------FRIHTTAEGLAGEDVPLE 52

  Fly    83 LP-HL---YPLLEQARVSVHTTLLGKSKEQRLKNDLEQYHGERREEDAEPYIFQLLSWLQDRIED 143
            |. ||   ||..... :||::..|.:::...:|   |:..||.|...:||.:.:|:.|.|..:..
  Rat    53 LAFHLPAGYPSCLPG-ISVNSERLTRAQCVTVK---EKLLGEARRLLSEPMVHELVLWTQQNLRH 113

  Fly   144 LLKRPASEFEVQQVASSDPQQPPATELQRIW---IYSHHIKSSAKRQELIRQ-ARQLELTG-FSR 203
            :|.:  :|.|......:.|:.  :|....:|   :...|:::..|..:::.: |.:|.||| ...
  Rat   114 ILSQ--TETESSNGTCTLPES--STVDGGLWMTLLRLDHMRARTKYVKVVEKWASELRLTGRLMF 174

  Fly   204 PGKPGIICVEGDSANVQEFWRTIKALRWQKISVVRTEPRQRK 245
            .||..:|.::||.:|::|:      |..||.|.|..:...:|
  Rat   175 MGKMILILLQGDRSNIKEY------LILQKTSKVDVDSSGKK 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30338NP_724811.1 DUF1115 175..>240 CDD:284060 19/66 (29%)
Rwdd3NP_001121624.1 RWD 3..111 CDD:399058 33/126 (26%)
Interaction with UBE2I/UBC9. /evidence=ECO:0000250|UniProtKB:Q9Y3V2 13..15 0/1 (0%)
Interaction with UBE2I/UBC9. /evidence=ECO:0000250|UniProtKB:Q9Y3V2 100..102 0/1 (0%)
DUF1115 146..258 CDD:399506 20/71 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.