DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30338 and rwdd2b

DIOPT Version :9

Sequence 1:NP_724811.1 Gene:CG30338 / 246548 FlyBaseID:FBgn0050338 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001068583.1 Gene:rwdd2b / 566444 ZFINID:ZDB-GENE-041001-119 Length:289 Species:Danio rerio


Alignment Length:292 Identity:88/292 - (30%)
Similarity:140/292 - (47%) Gaps:35/292 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 QLEELELLSSIYCAPGELHM-LDAGVVADFNEFLKDDKTKPATSLLSHLEYVVKLTLPGKQCVEV 79
            ||.|:|||.|::  |.|..: :|....|:...:::.....|.|| ......:||:..|. .|:.:
Zfish    10 QLAEIELLISMF--PSEEGLQVDEISHAELRAYVEGSAHTPPTS-RPQFSIMVKVENPA-ACITM 70

  Fly    80 RVELPHLYPLLEQARVSVHTTLLGKSKEQRLKNDLEQYHGERREEDAEPYIFQLLSWLQDRIEDL 144
            ....|:.|| .|...::|....|.:|::.:|.:||..|..|...  .|..:...:.|::|.    
Zfish    71 VCSYPNDYP-KELPDITVRCAELIRSQQMQLHSDLNNYLTENCR--GEVCVLSAVQWIKDN---- 128

  Fly   145 LKRPASEFEVQQVASSDPQQ-----PPATELQRIWIYSHHIKSSAKRQELIRQARQLELTGFSRP 204
                |..:..:..|.|:|::     .|.|...|:|||||||.:..||:.::..|::|.|:|||.|
Zfish   129 ----ACLYFTKSAAFSEPKKEHALTQPKTTFTRLWIYSHHIYNKIKRKNILEWAKELNLSGFSMP 189

  Fly   205 GKPGIICVEGDSANVQEFWRTIKALRWQKISVVR----------TEPR-QRKRGFEDFSEQLF-- 256
            |||||:||||..:...|||..:|.|.|::|.:..          ||.| :..|.|..|.|.:|  
Zfish   190 GKPGIVCVEGLQSVCDEFWARLKVLTWKRIMIRHREDVPLDSSWTEERIESLRKFTLFHEAIFYP 254

  Fly   257 -NAEEGVMNMGQFIRFLEAHGFGYMKSELFGL 287
             ..:...|::||..:||...|...:....||:
Zfish   255 HGTKGNHMDLGQLYQFLNDKGCADIFQLYFGI 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30338NP_724811.1 DUF1115 175..>240 CDD:284060 31/74 (42%)
rwdd2bNP_001068583.1 RWD 8..129 CDD:283440 33/133 (25%)
DUF1115 160..283 CDD:284060 45/122 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574435
Domainoid 1 1.000 76 1.000 Domainoid score I8956
eggNOG 1 0.900 - - E1_28IR6
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 118 1.000 Inparanoid score I4784
OMA 1 1.010 - - QHG53050
OrthoDB 1 1.010 - - D1387276at2759
OrthoFinder 1 1.000 - - FOG0004978
OrthoInspector 1 1.000 - - oto41294
orthoMCL 1 0.900 - - OOG6_103700
Panther 1 1.100 - - LDO PTHR15955
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5060
SonicParanoid 1 1.000 - - X3514
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1413.840

Return to query results.
Submit another query.