DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30338 and rwdd3

DIOPT Version :9

Sequence 1:NP_724811.1 Gene:CG30338 / 246548 FlyBaseID:FBgn0050338 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001017275.1 Gene:rwdd3 / 550029 XenbaseID:XB-GENE-960546 Length:265 Species:Xenopus tropicalis


Alignment Length:213 Identity:52/213 - (24%)
Similarity:95/213 - (44%) Gaps:33/213 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LEELELLSSIYCAPGELHMLDAGVVADFNEFLKDDKT--KPATSLLSHLEYVVKLTLPGKQCVEV 79
            |||:..||:|||..||..:|.:.|    |......:|  :..|....||:.:..|.         
 Frog     6 LEEVAALSAIYCRDGECEVLSSSV----NGITVMIQTGVQGITGSEIHLKLIFDLP--------- 57

  Fly    80 RVELPHLYPLLEQARVSVHTTLLGKSKEQRLKNDLEQYHGERREEDAEPYIFQLLSWLQDRIEDL 144
             ||.|...|     .:||.:..|.:::.:.|::.|.:   :.::...||.|..|:.|.|..:.:|
 Frog    58 -VEYPSSLP-----NISVSSEELTRAQRKDLRDKLVE---QAKQHILEPMIHDLVVWTQQNLNNL 113

  Fly   145 LKRP-ASEFEVQQVASSD--PQQPPATELQRIWIYSHHIKSSAKRQELIRQ-ARQLELTG-FSRP 204
            :.:| .|..|.....|.|  .::...|.|.|:    .|:::.:|..:.:.: ...|:|.| ....
 Frog   114 IVQPEPSILEGHFPLSLDTITEETTWTILLRL----DHMRAKSKYVKTVEKWTNDLKLCGRLMFL 174

  Fly   205 GKPGIICVEGDSANVQEF 222
            ||..:|.::||..:.:::
 Frog   175 GKLILILLQGDRKSTRDY 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30338NP_724811.1 DUF1115 175..>240 CDD:284060 10/50 (20%)
rwdd3NP_001017275.1 RWD 1..110 CDD:283440 33/125 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.