DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30338 and Rwdd2a

DIOPT Version :9

Sequence 1:NP_724811.1 Gene:CG30338 / 246548 FlyBaseID:FBgn0050338 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001102243.1 Gene:Rwdd2a / 363110 RGDID:1306231 Length:292 Species:Rattus norvegicus


Alignment Length:307 Identity:96/307 - (31%)
Similarity:149/307 - (48%) Gaps:51/307 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 EELQTYRRCVGLQLEELELLSSIYCAPGELHMLDAGVVADFNEFLKDDKTKPATSLLSHLEYVVK 68
            |.||       |||.|:|:|.|::...||:.:.|...:.:...:|  |.|:.|  |..::|:|:.
  Rat     7 ESLQ-------LQLLEMEMLFSMFPNQGEVKLEDVNALTNIKRYL--DGTREA--LPPNIEFVIT 60

  Fly    69 LTL-PGKQCVEVRVELPHLYPLLEQARVSVHTTLLGKSKE-----QRLKND-LEQYHGERREEDA 126
            |.: ..|..::::|.:||.||.       |...|.|:|.|     |.|.|. |..|.|  ..:..
  Rat    61 LQIEEPKVTIDLQVTMPHSYPY-------VALQLFGRSPELDRQQQLLLNQGLSAYLG--TFDPG 116

  Fly   127 EPYIFQLLSWLQDRIEDLLKRPASEFEVQQVASSDPQ---QPPATELQRIWIYSHHIKSSAKRQE 188
            |..:...:.||||.        ::.:.:.:..|.:|.   :|......|:|||||||.....|::
  Rat   117 ELCVCAAIQWLQDN--------SASYFLNRKLSDEPSVQPKPVKNTFLRMWIYSHHIYQQDLRKK 173

  Fly   189 LIRQARQLELTGFSRPGKPGIICVEGDSANVQEFWRTIKALRWQKISVVRTEPRQRK------RG 247
            ::...::|::|||...||||||||||...:.:|||.||:...|:.||....|..:.:      |.
  Rat   174 ILEVGKRLDVTGFCMTGKPGIICVEGFKDHCEEFWHTIRYPNWKHISCKHAETVETEGDGEDLRL 238

  Fly   248 FEDFSEQLFNA--EEGV-----MNMGQFIRFLEAHGFGYMKSELFGL 287
            |..|.|.|..|  :.|:     ||:|||:.||..|...::...|||:
  Rat   239 FHSFEELLLEAHGDYGLRNDYHMNLGQFLEFLRKHKSEHVFQILFGI 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30338NP_724811.1 DUF1115 175..>240 CDD:284060 29/64 (45%)
Rwdd2aNP_001102243.1 RWD 15..134 CDD:413438 37/139 (27%)
DUF1115 160..281 CDD:399506 45/120 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335164
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28IR6
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12315
Inparanoid 1 1.050 133 1.000 Inparanoid score I4503
OMA 1 1.010 - - QHG53050
OrthoDB 1 1.010 - - D1387276at2759
OrthoFinder 1 1.000 - - FOG0004978
OrthoInspector 1 1.000 - - otm45299
orthoMCL 1 0.900 - - OOG6_103700
Panther 1 1.100 - - O PTHR15955
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3514
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1312.810

Return to query results.
Submit another query.