DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30338 and RWDD3

DIOPT Version :9

Sequence 1:NP_724811.1 Gene:CG30338 / 246548 FlyBaseID:FBgn0050338 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_056300.3 Gene:RWDD3 / 25950 HGNCID:21393 Length:267 Species:Homo sapiens


Alignment Length:249 Identity:60/249 - (24%)
Similarity:97/249 - (38%) Gaps:66/249 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 EELELLSSIYCAPGELHMLDAGVVADFNEFLKDDKTKP------ATSLLSHLEYVVKLTLPG--- 73
            |||.:|::|:|.|.|..:|... ..|...|....|.:.      ...|:.||.......|||   
Human     7 EELSVLAAIFCRPHEWEVLSRS-ETDGTVFRIHTKAEGFMDVDIPLELVFHLPVNYPSCLPGISI 70

  Fly    74 -------KQCVEVRVELPHLYPLLEQARVSVHTTLLGKSKEQRLKNDLEQYHGERREEDAEPYIF 131
                   .|||.|:..      |||||.     :||                       :||.:.
Human    71 NSEQLTRAQCVTVKEN------LLEQAE-----SLL-----------------------SEPMVH 101

  Fly   132 QLLSWLQDRIEDLLKRPASEFEVQQVASSDPQQPPATELQRIWI---YSHHIKSSAKRQELIRQ- 192
            :|:.|:|..:..:|.:|.:....::...|    ...|....:||   :..|:::..|..:::.: 
Human   102 ELVLWIQQNLRHILSQPETGSGSEKCTFS----TSTTMDDGLWITLLHLDHMRAKTKYVKIVEKW 162

  Fly   193 ARQLELTG-FSRPGKPGIICVEGDSANVQEFWRTIKALRWQKISVVRTEPRQRK 245
            |..|.||| ....||..:|.::||..|::|:      |..||.|.|..:...:|
Human   163 ASDLRLTGRLMFMGKIILILLQGDRNNLKEY------LILQKTSKVDVDSSGKK 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30338NP_724811.1 DUF1115 175..>240 CDD:284060 20/69 (29%)
RWDD3NP_056300.3 RWD 8..114 CDD:214735 33/140 (24%)
Interaction with UBE2I/UBC9. /evidence=ECO:0000269|PubMed:25918163 13..15 0/1 (0%)
Interaction with UBE2I/UBC9. /evidence=ECO:0000269|PubMed:25918163 100..102 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
21.870

Return to query results.
Submit another query.