DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30338 and RWDD2A

DIOPT Version :9

Sequence 1:NP_724811.1 Gene:CG30338 / 246548 FlyBaseID:FBgn0050338 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_219479.2 Gene:RWDD2A / 112611 HGNCID:21385 Length:292 Species:Homo sapiens


Alignment Length:306 Identity:95/306 - (31%)
Similarity:147/306 - (48%) Gaps:49/306 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 EELQTYRRCVGLQLEELELLSSIYCAPGELHMLDAGVVADFNEFLKDDKTKPATSLLSHLEYVVK 68
            |.||       |||.|:|:|.|::...||:.:.|...:.:...:|:..:    .:|...:|:|:.
Human     7 ESLQ-------LQLLEMEMLFSMFPNQGEVKLEDVNALTNIKRYLEGTR----EALPPKIEFVIT 60

  Fly    69 LTL-PGKQCVEVRVELPHLYPLLEQARVSVHTTLLGKSKE-----QRLKN-DLEQYHGERREEDA 126
            |.: ..|..::::|.:||.||.       |...|.|:|.|     |.|.| .|..|.|  ..:..
Human    61 LQIEEPKVKIDLQVTMPHSYPY-------VALQLFGRSSELDRHQQLLLNKGLTSYIG--TFDPG 116

  Fly   127 EPYIFQLLSWLQDRIEDLLKRPASEFEVQQVA--SSDPQQPPATELQRIWIYSHHIKSSAKRQEL 189
            |..:...:.||||       ..||.|..:::.  .|...:|......|:|||||||.....|:::
Human   117 ELCVCAAIQWLQD-------NSASYFLNRKLVYEPSTQAKPVKNTFLRMWIYSHHIYQQDLRKKI 174

  Fly   190 IRQARQLELTGFSRPGKPGIICVEGDSANVQEFWRTIKALRWQKISVVRTEPRQRK------RGF 248
            :...::|::|||...||||||||||...:.:|||.||:...|:.||....|..:.:      |.|
Human   175 LDVGKRLDVTGFCMTGKPGIICVEGFKEHCEEFWHTIRYPNWKHISCKHAESVETEGNGEDLRLF 239

  Fly   249 EDFSEQLFNA--EEGV-----MNMGQFIRFLEAHGFGYMKSELFGL 287
            ..|.|.|..|  :.|:     ||:|||:.||:.|...::...|||:
Human   240 HSFEELLLEAHGDYGLRNDYHMNLGQFLEFLKKHKSEHVFQILFGI 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30338NP_724811.1 DUF1115 175..>240 CDD:284060 29/64 (45%)
RWDD2ANP_219479.2 RWD 15..134 CDD:214735 35/138 (25%)
DUF1115 160..281 CDD:399506 45/120 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141475
Domainoid 1 1.000 76 1.000 Domainoid score I8976
eggNOG 1 0.900 - - E1_28IR6
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12315
Inparanoid 1 1.050 120 1.000 Inparanoid score I4771
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53050
OrthoDB 1 1.010 - - D1387276at2759
OrthoFinder 1 1.000 - - FOG0004978
OrthoInspector 1 1.000 - - otm41157
orthoMCL 1 0.900 - - OOG6_103700
Panther 1 1.100 - - O PTHR15955
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5060
SonicParanoid 1 1.000 - - X3514
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1615.840

Return to query results.
Submit another query.