DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30338 and RWDD2B

DIOPT Version :9

Sequence 1:NP_724811.1 Gene:CG30338 / 246548 FlyBaseID:FBgn0050338 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_058636.1 Gene:RWDD2B / 10069 HGNCID:1302 Length:319 Species:Homo sapiens


Alignment Length:303 Identity:85/303 - (28%)
Similarity:141/303 - (46%) Gaps:56/303 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 QLEELELLSSIYCAPGELHMLDAGVVADFNEFLKDDKTKPATSLLSHLEYVV---------KLTL 71
            ||.||:||:|::....||.:.|...||:..:.: :.||....|  |.:.:.:         |:.:
Human    39 QLAELDLLASMFPGENELIVNDQLAVAELKDCI-EKKTMEGRS--SKVYFTINMNLDVSDEKMAM 100

  Fly    72 PGKQCVEVRVELPHLYPLLEQARVSVHTTLLGKSKEQRLKNDLEQY-----HGERREEDAEPYIF 131
            ....|:     ||..||.: ...::|.:.||.:|::.:|..||..:     ||       :..|.
Human   101 FSLACI-----LPFKYPAV-LPEITVRSVLLSRSQQTQLNTDLTAFLQKHCHG-------DVCIL 152

  Fly   132 QLLSWLQDRIEDLLKRPASEFEVQQVASSDPQQPPATE-----LQRIWIYSHHIKSSAKRQELIR 191
            ....|:::.....:.|.         .||.|......:     ..|:|||||||.:..||:.::.
Human   153 NATEWVREHASGYVSRD---------TSSSPTTGSTVQSVDLIFTRLWIYSHHIYNKCKRKNILE 208

  Fly   192 QARQLELTGFSRPGKPGIICVEGDSANVQEFWRTIKALRWQKISVVRTE---------PRQRKRG 247
            .|::|.|:|||.|||||::||||..:..:|||..::.|.|::|.:...|         ..:|:|.
Human   209 WAKELSLSGFSMPGKPGVVCVEGPQSACEEFWSRLRKLNWKRILIRHREDIPFDGTNDETERQRK 273

  Fly   248 FEDFSEQLFN---AEEGVMNMGQFIRFLEAHGFGYMKSELFGL 287
            |..|.|::|:   |....|:.||..:||...|.|.:....||:
Human   274 FSIFEEKVFSVNGARGNHMDFGQLYQFLNTKGCGDVFQMFFGV 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30338NP_724811.1 DUF1115 175..>240 CDD:284060 29/64 (45%)
RWDD2BNP_058636.1 RWD 37..162 CDD:310403 33/138 (24%)
DUF1115 192..310 CDD:310859 44/117 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141474
Domainoid 1 1.000 76 1.000 Domainoid score I8976
eggNOG 1 0.900 - - E1_28IR6
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 120 1.000 Inparanoid score I4771
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53050
OrthoDB 1 1.010 - - D1387276at2759
OrthoFinder 1 1.000 - - FOG0004978
OrthoInspector 1 1.000 - - otm41157
orthoMCL 1 0.900 - - OOG6_103700
Panther 1 1.100 - - LDO PTHR15955
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5060
SonicParanoid 1 1.000 - - X3514
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1413.840

Return to query results.
Submit another query.