DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sema2b and smp-2

DIOPT Version :9

Sequence 1:NP_001261024.1 Gene:Sema2b / 246538 FlyBaseID:FBgn0264273 Length:824 Species:Drosophila melanogaster
Sequence 2:NP_491197.3 Gene:smp-2 / 183905 WormBaseID:WBGene00004890 Length:649 Species:Caenorhabditis elegans


Alignment Length:567 Identity:152/567 - (26%)
Similarity:238/567 - (41%) Gaps:110/567 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 HLRHHKEHVQDFSCGPLHYKTFYMDERN----------NALYVGAMDRIF--------------R 144
            |||     :..|...||...:|:..:.|          .||..||.:::.              |
 Worm     3 HLR-----IFIFLLAPLGSASFFNPDTNVSRVDVSHLSRALSYGANEKLVILHKLPGEYVLLGGR 62

  Fly   145 LNLRNIS-QSICERDVLILEPTGSD--ILNCVSKGKREKVECRNHIRVIQPMNFNGQKLYVCGTN 206
            .::.||| .|:.|  :...|.|.||  ..||.:. .:....|.|.||..  .......|.:|||:
 Worm    63 NHVYNISISSMLE--IARYEWTSSDEARTNCAAI-SQTPASCENFIRTY--FELTNDTLILCGTH 122

  Fly   207 AHNPKDYVI---NANLTHLPRSQYVPGIGLGIGKCPYDPADNSTAVYV-ENGNPFGLPALYAGTN 267
            |..|.....   ||....|..:         :|..|.| || |||.:: .|.|      :.....
 Worm   123 ALQPTCAEFRKGNAKPQRLISA---------VGMSPID-AD-STAPFIRSNEN------IITVNV 170

  Fly   268 AEFTKADSVIFRSDLYNLTNGRKEANFKRTVKYDSKLLDKPNFVGSFEIGEFVYFFFREHAVEYI 332
            ||.:.::.::.|.::..:..|.:.....||.:..|. .::.||:...::.:.|.|||.|..:|..
 Worm   171 AELSSSEPLLVRRNVIKMWKGIENDVILRTPRGLSS-FEQANFLSMHKVKKEVLFFFSESPMETE 234

  Fly   333 NCGKAVYSRVARVCKNDRGGKYMISQNWATYLKARMNCSI--SSEFPFYFNEIQSVYKMPTDDTK 395
            .||....:||.|||::|.||:...::.|::|.|||:.|||  :....||||:...|.:.|   |.
 Worm   235 GCGLHKVARVGRVCEDDPGGRLSYNKEWSSYEKARIECSIEETDTDTFYFNQFAGVAESP---TS 296

  Fly   396 FYATFTTNTNGLIGSAVCSYDIRDINAAFDGKFKEQATSNSAWLPVLNSKVPEPRPGTCH--NDT 458
            ||..|.:...|:..||:|.|..:.|:.:|...:||..                  |.||.  ||.
 Worm   297 FYGAFRSQLAGIGASAICKYSKKVISGSFASGYKEST------------------PDTCSRANDI 343

  Fly   459 ATLPDSVLNFIRKHPLMDKAVDHEFGNP--VFFKRDVILTKLVVDKIRIDKLNQEFLVYFVATTS 521
                 ..|:.||..||:.:.:.   .||  :|..:|..:..|..:..| |..|:.:.:.:|||..
 Worm   344 -----EELSRIRLKPLIKQKIS---ANPIYIFHGKDRFVHVLAQEDTR-DLSNRAYDILYVATNL 399

  Fly   522 GHIYKI-VQFMHYGQRHSNLVDIFEASPHSEPIREMTLSHKTG--SLYVATDHQVKQIDIAMCAR 583
            |:|.|| |.......||:..:.:.   |.:..|.:|:|..|..  .|.|.|:..|.::..|.| .
 Worm   400 GNILKIVVPSTDKTGRHAVTLKVL---PTNSKIVDMSLYSKNNLEELIVITEQSVLKVPTATC-H 460

  Fly   584 RYDSCFRCVS--DPYCGWDKDVNA--CRPYQLGLLQDVANETSGICD 626
            ...:|..|::  ||:|.|...|:.  .|..|    :..|::.||.||
 Worm   461 LASNCAECLAHGDPHCAWADGVDCIDIRTDQ----RKSASQDSGTCD 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sema2bNP_001261024.1 Sema_2A 120..579 CDD:200499 131/498 (26%)
Ig 632..720 CDD:299845
smp-2NP_491197.3 Sema 47..429 CDD:214747 116/437 (27%)
Sema <390..478 CDD:387663 26/91 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3611
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11036
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.