DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sema2b and sema4g

DIOPT Version :9

Sequence 1:NP_001261024.1 Gene:Sema2b / 246538 FlyBaseID:FBgn0264273 Length:824 Species:Drosophila melanogaster
Sequence 2:XP_002938767.1 Gene:sema4g / 100038182 XenbaseID:XB-GENE-856594 Length:830 Species:Xenopus tropicalis


Alignment Length:656 Identity:195/656 - (29%)
Similarity:295/656 - (44%) Gaps:117/656 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 FSCGPLHYKTFYMDERNNALYVGAMDRIFRLNLRNISQSICERDVLILEPTGSDILNCVSKGKRE 179
            ||....:|.|..:::....|||||...||.||..||||..  :..:..|.|......|:.|||..
 Frog    49 FSSRVSNYSTLLLEDERGILYVGARGAIFSLNSTNISQRY--QKAIPWEVTAQKHDECIKKGKNN 111

  Fly   180 KVECRNHIRVIQPMNFNGQKLYVCGTNAHNP-------KDYVINANLTHLPRSQYVPGIGLGIGK 237
            :.||.||||::  :.||...||||||.|.:|       :.:|:::....            |..|
 Frog   112 QTECFNHIRLL--LRFNETHLYVCGTYAFSPLCSFIDSRTFVLSSETEE------------GKEK 162

  Fly   238 CPYDPADNSTAVYVENGNPFGLPALYAGTNAEFTKADSVIFRSDLYNLTNGRKEANFKRTVKYDS 302
            ||||||.....:.|:.|       ||..:..||.....:  |.:|...:...:|:|.        
 Frog   163 CPYDPAKGYVGLLVDGG-------LYTASLYEFRNLPDI--RRNLLQRSLKTEESNL-------- 210

  Fly   303 KLLDKPNFVG--------SFEIG--EFVYFFFREHAVEYINC--GKAVYSRVARVCKNDRGGKYM 355
            ..|:.|.||.        :.|:|  :.:|:||.|..||..:.  |....| ||||||:|.|||.:
 Frog   211 HWLNDPEFVSAALVQESMNVEVGDDDKIYYFFNEKVVEENSAFLGSKTAS-VARVCKDDMGGKKI 274

  Fly   356 ISQNWATYLKARMNCSISSEFPFYFNEIQSVYKMPT---DDTKFYATFTTNTNGLIGSAVCSYDI 417
            :.:.|.::||||:.|.:    ||| ..::|.|.:..   |.|.||..|......:..||:|.|.|
 Frog   275 LQKKWTSFLKARLVCYM----PFY-EVLKSAYTLELGSWDTTIFYGAFILQWKNMEESAICRYSI 334

  Fly   418 RDINAAFDGKFKEQATSNSAWLPVLNSKVPEPRPGTC---------HNDTATLPDSVLNFIRKHP 473
            .||...|:|.:.|...|:..| .....:||.||||:|         .|.:..||::||:|::.||
 Frog   335 SDIQKVFEGPYMEYQYSSRKW-SRYEGEVPSPRPGSCITNEFRMNGFNTSQDLPNNVLDFVKLHP 398

  Fly   474 LMDKAVDHEFGNPVFFKRDVILTKLVVDKIRIDKLNQEFL-VYFVATTSGHIYKIV---QFMHYG 534
            ||.:.|......|:..|:::|.|::.||  |:..||.|:. |.|:.|..|.|:|.|   ..:|  
 Frog   399 LMYEKVRPVGEQPLLVKKNIIYTRIAVD--RVKALNDEYYDVLFLGTDDGWIHKAVVIGSMVH-- 459

  Fly   535 QRHSNLVDIFEASPHSEPIREMTLSHKTGSLYVATDHQVKQIDIAMCARRYDSCFRCV--SDPYC 597
                 :::..:.....:|:..:.:|.|..:||:.....|.||.:..|: :|.||:.|:  .:|||
 Frog   460 -----IIEEIQVYKFPQPVENLVISKKQNALYIGAQSGVLQIPLFGCS-QYTSCYDCILARNPYC 518

  Fly   598 GWDKDVNACRPY-----QLGLLQDVANETSGIC----DTSVLRKKVTSSY-GQTLHLSCFVKMPE 652
            .||.  :|||..     :..:.||:.|...| |    |...|:|:|.... |..:.|.|      
 Frog   519 AWDG--HACRDIIGAKNRTQMTQDMQNGNGG-CLNSTDDGALKKRVRRVLKGNDVLLQC------ 574

  Fly   653 VLRKKQTR--WYHHSTEKGRYEVRYTPTKYIDTNEGGLVLLAVNEGDGGRYDSYLD----GTLLC 711
            .||....|  ||.:.|:|     .|....:......||::........|.|..|.:    .:|:.
 Frog   575 ELRSNLARPQWYVNGTDK-----LYDSEGHTRLGVDGLLITDTLPEHSGEYSCYSEENGLQSLVA 634

  Fly   712 SYGVTV 717
            .|.:.|
 Frog   635 VYSLNV 640

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sema2bNP_001261024.1 Sema_2A 120..579 CDD:200499 152/493 (31%)
Ig 632..720 CDD:299845 21/93 (23%)
sema4gXP_002938767.1 Sema 47..499 CDD:417757 154/498 (31%)
PSI 500..>527 CDD:214655 12/29 (41%)
Ig_Sema4B_like 557..643 CDD:409456 22/95 (23%)
Ig strand B 570..574 CDD:409456 1/3 (33%)
Ig strand C 582..586 CDD:409456 1/3 (33%)
Ig strand E 605..609 CDD:409456 2/3 (67%)
Ig strand F 619..624 CDD:409456 1/4 (25%)
Ig strand G 636..639 CDD:409456 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11036
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.