DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht12 and AT4G19820

DIOPT Version :9

Sequence 1:NP_726022.1 Gene:Cht12 / 246535 FlyBaseID:FBgn0050293 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_001320000.1 Gene:AT4G19820 / 827726 AraportID:AT4G19820 Length:368 Species:Arabidopsis thaliana


Alignment Length:344 Identity:79/344 - (22%)
Similarity:134/344 - (38%) Gaps:67/344 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 LDSRLCTHLVLGSGIGVDGDSGELRITDKILLLEKDKLSS-VKTM-KWDSIKKVMFTIGGWEEDS 109
            :||.|.|||....     .|...|.....:....|.|.|: .:|: :.:...|.:.:|||....:
plant    42 IDSSLFTHLFCAF-----ADINTLTYQVIVSSRNKPKFSTFTQTVRRRNPTVKTLLSIGGDFTYN 101

  Fly   110 SSFSRMVASPKKRDNFYSSMLEFMFRWGFDGVQIDWRYPTLLGGHPDDRQNFVILLEELGLIFR- 173
            .:|:.|.::|..|..|.||.::.....||.|:.::|:||::    ..:..||..||.|..|... 
plant   102 FAFASMASNPTSRKLFISSSIKLARSCGFHGLDLNWKYPSI----TTEMDNFGKLLREWRLAVEA 162

  Fly   174 ------KNQLILMVAVLGRRDNRILESYN-------IPEIVNHSDFIHLMMHDEQDPYHLRLAYN 225
                  |.:|:|..||        ..||:       :..:.:..|:::|:.:|..:....|:..:
plant   163 EARSSGKPRLLLTAAV--------FYSYSYYSVLHPVNAVADSLDWVNLVAYDFYESGSSRVTCS 219

  Fly   226 -APLVGYEGSVTD-----SIMHWKRNGGAPEKLILGIPLFVRSFTM-DRNQSTVGSACKGPGRQT 283
             |||  |:...|.     .:..|.:.|...:|.:||.||:..::.: |.......:...||....
plant   220 PAPL--YDPITTGPSGDAGVRAWTQAGLPAKKAVLGFPLYGYAWCLTDAKNHNYYANSSGPAISP 282

  Fly   284 KQS-----------HRPGFMTYNEWCVQQSKWSRMFDQLAKVPYATRGDQWVSYENPRSIWAKMH 337
            ..|           .....|.||...||.              |......|:.|::.:||..|:.
plant   283 DGSIGYDQIRRFIVDNKATMVYNSNLVQN--------------YCYAKKTWIGYDDNQSIVMKVK 333

  Fly   338 LLQEHKLGGAMAWTIDVDD 356
            ..::..|.|..:|.|..||
plant   334 YAKQRGLLGYFSWHIGADD 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht12NP_726022.1 GH18_chitinase-like 25..375 CDD:299167 79/344 (23%)
Glyco_hydro_18 47..355 CDD:279094 77/341 (23%)
ChtBD2 394..438 CDD:214696
AT4G19820NP_001320000.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I1632
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11177
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X91
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.920

Return to query results.
Submit another query.