DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht12 and ChiC

DIOPT Version :9

Sequence 1:NP_726022.1 Gene:Cht12 / 246535 FlyBaseID:FBgn0050293 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_001319999.1 Gene:ChiC / 827725 AraportID:AT4G19810 Length:379 Species:Arabidopsis thaliana


Alignment Length:395 Identity:87/395 - (22%)
Similarity:156/395 - (39%) Gaps:74/395 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTSFQYVFMIM---IFLICGCIAKEYNVFCQYDLGSYYYKGRSQFFEWHLDSRLCTHLVLGSGIG 62
            |:|.:.:.:|:   .||...|...:..|     ..||::.. |:|....:||.|.|||....   
plant     1 MSSTKLISLIVSITFFLTLQCSMAQTVV-----KASYWFPA-SEFPVTDIDSSLFTHLFCAF--- 56

  Fly    63 VDGDSGELRITDKILLLEKDKLSSVKTMKWDSIK----------KVMFTIGGWEEDSSSFSRMVA 117
            .|.:|...::|          :||....|:.:..          |.:.:|||...|.::::.|.:
plant    57 ADLNSQTNQVT----------VSSANQPKFSTFTQTVQRRNPSVKTLLSIGGGIADKTAYASMAS 111

  Fly   118 SPKKRDNFYSSMLEFMFRWGFDGVQIDWRYPTLLGGHPDDRQNFVILLEELGLIFR--------- 173
            :|..|.:|..|.:.....:||.|:.:||.||:    ...:..||..||.|    :|         
plant   112 NPTSRKSFIDSSIRVARSYGFHGLDLDWEYPS----SATEMTNFGTLLRE----WRSAVVAEASS 168

  Fly   174 --KNQLILMVAVLGRRDNRILESYNIPEIVNHSDFIHLMMHDEQDPYHLRLA------YNAPLVG 230
              |.:|:|..||. ..:|.....|.:..:.:..|:::||.:|...|...|:.      ::....|
plant   169 SGKPRLLLAAAVF-YSNNYYSVLYPVSAVASSLDWVNLMAYDFYGPGWSRVTGPPAALFDPSNAG 232

  Fly   231 YEGSVTDSIMHWKRNGGAPEKLILGIPLFVRSFTMDRNQS------TVGSACKGPGRQTKQSHRP 289
            ..|..  ....|.:.|...:|.:||.|.:..::.:....|      |.|:|....|       ..
plant   233 PSGDA--GTRSWIQAGLPAKKAVLGFPYYGYAWRLTNANSHSYYAPTTGAAISPDG-------SI 288

  Fly   290 GFMTYNEWCVQQSKWSRMFDQLAKVPYATRGDQWVSYENPRSIWAKMHLLQEHKLGGAMAWTIDV 354
            |:....::.|.... :.:::......|...|..|:.|::.:||..|:...::..|.|..:|.:..
plant   289 GYGQIRKFIVDNGA-TTVYNSTVVGDYCYAGTNWIGYDDNQSIVTKVRYAKQRGLLGYFSWHVGA 352

  Fly   355 DDFRG 359
            ||..|
plant   353 DDNSG 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht12NP_726022.1 GH18_chitinase-like 25..375 CDD:299167 81/368 (22%)
Glyco_hydro_18 47..355 CDD:279094 73/340 (21%)
ChtBD2 394..438 CDD:214696
ChiCNP_001319999.1 GH18_plant_chitinase_class_V 25..359 CDD:119358 81/371 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I1632
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11177
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X91
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.920

Return to query results.
Submit another query.