DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht12 and AT4G19800

DIOPT Version :9

Sequence 1:NP_726022.1 Gene:Cht12 / 246535 FlyBaseID:FBgn0050293 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_193715.1 Gene:AT4G19800 / 827724 AraportID:AT4G19800 Length:398 Species:Arabidopsis thaliana


Alignment Length:364 Identity:88/364 - (24%)
Similarity:145/364 - (39%) Gaps:81/364 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SYYYKGRSQFFEWHLDSRLCTHLVLGSGIGVDGDSGELRI-----------TDKILLLEKDKLSS 86
            ||::.. :.|....:||.|.|||.. :...::.:|.|:.|           |:.:    :.:...
plant    10 SYWFPA-TDFPATDIDSSLFTHLFC-TFADLEAESYEITIATWNQAPFHAFTETV----QQRNPH 68

  Fly    87 VKTMKWDSIKKVMFTIGGWEEDSSSFSRMVASPKKRDNFYSSMLEFMFRWGFDGVQIDWRYPTLL 151
            |||         :.:|||...|..:|:.|.::|..|.:|..|.:.....:||.|:.:||.||.  
plant    69 VKT---------LLSIGGGNADKDAFASMASNPDSRASFIQSTITVARSYGFHGLDLDWEYPR-- 122

  Fly   152 GGHPDDRQNFVILLEELGLIFRK-----------NQLILMVAVLGRRDNRILESYNIPEIVNHSD 205
              :.::..:|..||||    :|.           ..|||..||. ...|.....|.:..|.|..|
plant   123 --NEEEMYDFGKLLEE----WRSAVEAESNSSGTTALILTAAVY-YSSNYQGVPYPVLAISNSLD 180

  Fly   206 FIHLMMHD---------EQDPYHLRLAYNAPLVGYEGSVTDSIMHWKRNGGAPEKLILGIPLFVR 261
            :|:||.:|         ...|..|.|    |..|..|.  ..:..|...|...:|.:||.|.:..
plant   181 WINLMAYDFYGPGWSTVTGPPASLYL----PTDGRSGD--SGVRDWTEAGLPAKKAVLGFPYYGW 239

  Fly   262 SFTM---DRN---QSTVGSACKGPGRQTKQSHRPGFMTYNE---WCVQQSKWSRMFDQLAKVPYA 317
            ::|:   |.|   .:|.|.|....|.          ::|.:   |.|.... :::.|.:....|.
plant   240 AWTLADPDVNGYDANTTGPAISDDGE----------ISYRQLQTWIVDNGA-TKVHDDMMVGDYC 293

  Fly   318 TRGDQWVSYENPRSIWAKMHLLQEHKLGGAMAWTIDVDD 356
            ..|..|:.|::.:||..|:...::..|.|..:|.:..||
plant   294 YAGTTWIGYDSEKSIVTKVIYAKQKGLLGYFSWHVGGDD 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht12NP_726022.1 GH18_chitinase-like 25..375 CDD:299167 88/364 (24%)
Glyco_hydro_18 47..355 CDD:279094 83/347 (24%)
ChtBD2 394..438 CDD:214696
AT4G19800NP_193715.1 GH18_plant_chitinase_class_V 4..337 CDD:119358 88/364 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I1632
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11177
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X91
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.920

Return to query results.
Submit another query.