DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht12 and AT4G19760

DIOPT Version :9

Sequence 1:NP_726022.1 Gene:Cht12 / 246535 FlyBaseID:FBgn0050293 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_193711.2 Gene:AT4G19760 / 827720 AraportID:AT4G19760 Length:369 Species:Arabidopsis thaliana


Alignment Length:380 Identity:86/380 - (22%)
Similarity:150/380 - (39%) Gaps:90/380 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SYYY-KGRSQFFEW--------HLDSRLCTHLVLGSGIGVDGDSGELRI-----------TDKIL 77
            ||:: .|:||..|.        .:||.|.|||..... .||..:.|:.|           |:.: 
plant    17 SYWFPDGKSQSPECLSQGTPSSFIDSTLFTHLFCAFA-DVDSSTHEVTISAANSYQFSSFTETV- 79

  Fly    78 LLEKDKLSSVKTMKWDSIKKVMFTIGGWEEDSSSFSRMVASPKKRDNFYSSMLEFMFRWGFDGVQ 142
               |:|.:.|:|         :.:|||.:.|.:..:.|.::.|.|..|..|.::...:..|.|:.
plant    80 ---KEKNTDVQT---------LLSIGGKDADKAVLASMASNSKNRKAFIDSSIDIARKKDFYGLD 132

  Fly   143 IDWRYPTLLGGHPDDRQNFVILLEELGLIF-----RKNQL-ILMVAVLGRRDNRILESYNIPEIV 201
            :.|.||:    :..:..||..||||.....     :.||| :|:.|.:..........|.:..|.
plant   133 LAWEYPS----NDVEMTNFGKLLEEWRAAVVEESDKTNQLPLLLTAAVYYSPQYDGVEYPVKAIA 193

  Fly   202 NHSDFIHLMMHDEQDPYHLRLAYNAPLVGYEGSV-TDSIMHWKRNGGA------------PEKLI 253
            ::.||:::|.:|...|..      :|:.|...:: .|......|:|.:            |:|.:
plant   194 DNLDFVNIMAYDFYGPGW------SPVTGPPAALFHDPSNPAGRSGNSGLRKWLDEAKLPPKKAV 252

  Fly   254 LGIPLFVRSFTMD------RNQSTVGSACKGPGRQTKQSHR-----PGFMTYNEWCVQQSKWSRM 307
            ||.|....::|::      .:.:|.|:|....|..|....|     .|..|:::..|...     
plant   253 LGFPYCGWAWTLEDAENNGYDAATDGAAISPDGSITYAKIRNYIVDNGAATFHDPAVIGF----- 312

  Fly   308 FDQLAKVPYATRGDQWVSYENPRSIWAKMHLLQEHKLGGAMAWTIDVDDFRGRCG 362
                    |...|:.|:.|::.:||..|:...:...|.|..:|.:..|   ..||
plant   313 --------YCYVGNTWIGYDDNQSIVYKVKYAKFTGLLGYFSWHVGAD---YNCG 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht12NP_726022.1 GH18_chitinase-like 25..375 CDD:299167 86/380 (23%)
Glyco_hydro_18 47..355 CDD:279094 77/348 (22%)
ChtBD2 394..438 CDD:214696
AT4G19760NP_193711.2 GH18_plant_chitinase_class_V 11..358 CDD:119358 86/380 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I1632
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11177
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X91
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.920

Return to query results.
Submit another query.