DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht12 and Ctbs

DIOPT Version :9

Sequence 1:NP_726022.1 Gene:Cht12 / 246535 FlyBaseID:FBgn0050293 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_112285.1 Gene:Ctbs / 81652 RGDID:621338 Length:367 Species:Rattus norvegicus


Alignment Length:385 Identity:85/385 - (22%)
Similarity:142/385 - (36%) Gaps:97/385 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KEYNVFCQYDLGSYYYKGRSQFFEWHLDSRLCTHLVLGSGIGVDGDSGELRITDKILLLEKDKLS 85
            :::.||. :|:|...:|.    ::|   |::.|..|.|            :...:::.....|.:
  Rat    41 RDFEVFV-FDVGQKTWKS----YDW---SQITTVAVFG------------KYDSELMCYAHSKGA 85

  Fly    86 SVKTMKWD-SIKKVMFTIGGWEEDSSSFSRMVASPKKRDNFYSSMLEFMFRWGFDGVQIDW---- 145
            .| .:|.| ::|.::                  :|..|.::.:..:........||:.||.    
  Rat    86 RV-VLKGDVALKDII------------------NPTFRASWIAQKVALAKAQHMDGINIDIEQEV 131

  Fly   146 -----RYPTLLGGHPDDRQNFVILLEELGLIFRKNQLILMVAVLGRR-DNRILESYNIPEIVNHS 204
                 .|..|.....:..:.|...:|       .:|:...||...:. |.|   .||...|.:..
  Rat   132 DCSSPEYEALTALVRETTEGFHREIE-------GSQVTFDVAWSPKGIDKR---CYNYTGIADAC 186

  Fly   205 DFIHLMMHDEQDPY------HLRLAYNAPLVGYEGSVTDSIMHWKRNGGAPEKLILGIPLFVRSF 263
            ||:.:|.:|||...      .....||..|.||.        .:.|.|.:|.||::|||.:...:
  Rat   187 DFLFVMSYDEQSQIWSECIAAANAPYNQTLTGYG--------DYLRMGISPRKLVMGIPWYGYDY 243

  Fly   264 -TMDRNQSTVGSACKGPGRQTKQSHRPG-------FMTYNEWCVQQSKWSRMFDQLAKVPYATRG 320
             .::.::..|.:..|.|.|....|...|       .|......|..|:|::  ||.|  ||....
  Rat   244 ICLNLSKDDVCAIAKVPFRGAPCSDAAGHQVPYRVIMKQVNSSVSGSQWNQ--DQQA--PYYNYK 304

  Fly   321 D-----QWVSYENPRSIWAKMHLLQEHKLGGAMAWTIDVDDF------RGRCGEQHGLLR 369
            |     ..|.|:|||||..|...::.:.|.|...|..:..|:      |.:..|..|.||
  Rat   305 DPTGRLHQVWYDNPRSISLKAAFVKHYGLRGIGMWNANCLDYSDDALAREQTEEMWGALR 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht12NP_726022.1 GH18_chitinase-like 25..375 CDD:299167 85/381 (22%)
Glyco_hydro_18 47..355 CDD:279094 73/337 (22%)
ChtBD2 394..438 CDD:214696
CtbsNP_112285.1 GH18_chitobiase 23..363 CDD:119354 83/382 (22%)
Glyco_18 <100..343 CDD:214753 64/264 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.