DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Cht12 and Muc26B

DIOPT Version :9

Sequence 1:	NP_726022.1	Gene:	Cht12 / 246535	FlyBaseID:	FBgn0050293	Length:	470	Species:	Drosophila melanogaster
Sequence 2:	NP_652552.1	Gene:	Muc26B / 50424	FlyBaseID:	FBgn0040950	Length:	471	Species:	Drosophila melanogaster

Alignment Length:	50	Identity:	14/50 - (28%)
Similarity:	23/50 - (46%)	Gaps:	2/50 - (4%)

- Green bases have known domain annotations that are detailed below.

  Fly   397 DGFSRDGW-DCRLYHECRDGERIYYECLEGQYFDENQIVCRPAAEVKCDQ 445
            |||..... .|..|:.||.|:.:...|.: :||:..:.:|......:|.|
  Fly   420 DGFMLASLKSCSDYYICRYGKPLLVSCGD-KYFNALKGICDLPENTRCVQ 468

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Cht12	NP_726022.1	GH18_chitinase-like	25..375	CDD:299167
		Glyco_hydro_18	47..355	CDD:279094
		ChtBD2	394..438	CDD:214696	12/41 (29%)
Muc26B	NP_652552.1	CBM_14	43..86	CDD:279884
Muc26B	NP_652552.1	CBM_14	415..463	CDD:279884	12/43 (28%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG3325
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	0.900