DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht12 and T01C4.8

DIOPT Version :9

Sequence 1:NP_726022.1 Gene:Cht12 / 246535 FlyBaseID:FBgn0050293 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_001033501.1 Gene:T01C4.8 / 3896840 WormBaseID:WBGene00044546 Length:122 Species:Caenorhabditis elegans


Alignment Length:88 Identity:21/88 - (23%)
Similarity:30/88 - (34%) Gaps:39/88 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   336 MHLLQEHKLGGAMAWTIDVDDFRGRCGEQHGLLRVIFSALGDKNGLTTEKPTTEASGLCPHDGFS 400
            |.......|.|.|.|.:|:||      :...||.::.||                 |||  .|.|
 Worm     1 MDYATNRNLRGLMIWALDLDD------DADTLLNLVSSA-----------------GLC--SGGS 40

  Fly   401 RDGWDCRLYHECRDGERIYYECL 423
                          |::|.|:|:
 Worm    41 --------------GDKITYKCV 49

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht12NP_726022.1 GH18_chitinase-like 25..375 CDD:299167 11/38 (29%)
Glyco_hydro_18 47..355 CDD:279094 6/18 (33%)
ChtBD2 394..438 CDD:214696 7/30 (23%)
T01C4.8NP_001033501.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164367
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1289629at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.