DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht12 and btb-18

DIOPT Version :9

Sequence 1:NP_726022.1 Gene:Cht12 / 246535 FlyBaseID:FBgn0050293 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_872066.2 Gene:btb-18 / 353391 WormBaseID:WBGene00018201 Length:298 Species:Caenorhabditis elegans


Alignment Length:91 Identity:21/91 - (23%)
Similarity:36/91 - (39%) Gaps:28/91 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 MVASPKKRDNFYSSMLEFMFRWGFDGVQIDWRYPTLLGGHPDDRQNFVILLEELGLIFRKNQLIL 179
            :|.:|.:|::     :|.||.:..    ..|..|.     |..|       :|:.|...||..:|
 Worm   101 IVENPTRREH-----VEVMFEYSL----TPWLRPL-----PFSR-------DEIFLPSEKNDAVL 144

  Fly   180 MVAVLGRRDNRILESYNIPEIVNHSD 205
               |:|.|...:.:.:    :..|||
 Worm   145 ---VIGERKLHVNKDF----LCYHSD 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht12NP_726022.1 GH18_chitinase-like 25..375 CDD:299167 21/91 (23%)
Glyco_hydro_18 47..355 CDD:279094 21/91 (23%)
ChtBD2 394..438 CDD:214696
btb-18NP_872066.2 BTB 141..237 CDD:197585 7/30 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.