DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht12 and CG8460

DIOPT Version :9

Sequence 1:NP_726022.1 Gene:Cht12 / 246535 FlyBaseID:FBgn0050293 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_609190.2 Gene:CG8460 / 34115 FlyBaseID:FBgn0031996 Length:402 Species:Drosophila melanogaster


Alignment Length:230 Identity:53/230 - (23%)
Similarity:91/230 - (39%) Gaps:46/230 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 GFDGVQID-WRYPTLLGGHPDDRQNFVILLEELGLIFRKNQ--LILMVAVLGRRDNRILESYNIP 198
            ||||:.:: |   :.|.|..||:..:.::| ::....:|.|  |||::....:....:....::.
  Fly   194 GFDGLVLEVW---SQLAGRIDDKILYTLVL-QMAKELQKQQLRLILVIPPFRKETGHLFGEKHMD 254

  Fly   199 EIVNHSDFIHLMMHDEQDPYHLRLAYNAPLVGYEGSVTDSIMHWKRNGGAPE----------KLI 253
            ::..|.....||.:|.....  |...||||. :.....::|        |||          |::
  Fly   255 KLFKHIYAFSLMTYDFSSVQ--RPGANAPLY-FVRKAVETI--------APEGCADMTAKRAKIL 308

  Fly   254 LGIPLFVRSFTMDRNQSTVGSACKGPGRQTKQSHRPGFMTYNEWCVQQSKWSRMFDQLAKVPYAT 318
            ||:.::...:|.|.......|......|..|:     .:||:|..|:.      |.::..    .
  Fly   309 LGLNMYGNDYTPDGGGPITFSQYLDLVRHVKK-----HLTYDERDVEN------FFEIKN----D 358

  Fly   319 RGDQWVSYENPRSIWAKMHLLQEHKLG-GAMAWTI 352
            .|...|.|....||..::.|.||  || |...|.:
  Fly   359 DGRHIVFYPTLYSINERIKLAQE--LGTGISIWEL 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht12NP_726022.1 GH18_chitinase-like 25..375 CDD:299167 53/230 (23%)
Glyco_hydro_18 47..355 CDD:279094 53/230 (23%)
ChtBD2 394..438 CDD:214696
CG8460NP_609190.2 GH18_SI-CLP 81..402 CDD:119355 53/230 (23%)
Glyco_18 86..393 CDD:214753 53/230 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463833
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.