powered by:
Protein Alignment Cht12 and Cda5
DIOPT Version :9
Sequence 1: | NP_726022.1 |
Gene: | Cht12 / 246535 |
FlyBaseID: | FBgn0050293 |
Length: | 470 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_722590.2 |
Gene: | Cda5 / 33158 |
FlyBaseID: | FBgn0051973 |
Length: | 1998 |
Species: | Drosophila melanogaster |
Alignment Length: | 66 |
Identity: | 17/66 - (25%) |
Similarity: | 24/66 - (36%) |
Gaps: | 8/66 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 379 NGLTTEKPTTEASGLCPHDGFSRDGWDCRLYHECRDGERIYYECLEGQYFDENQIVCRPAAEVKC 443
||.:.:.| |..|..||.. ||..|:.|..|..:...|..|..:..:...|.....|.|
Fly 52 NGPSFDCP--EEFGYYPHPS------DCTQYYVCVFGGALLESCTGGLMYSHDLQTCDWPRNVGC 108
Fly 444 D 444
:
Fly 109 E 109
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45463825 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.