DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht12 and Cda5

DIOPT Version :9

Sequence 1:NP_726022.1 Gene:Cht12 / 246535 FlyBaseID:FBgn0050293 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_722590.2 Gene:Cda5 / 33158 FlyBaseID:FBgn0051973 Length:1998 Species:Drosophila melanogaster


Alignment Length:66 Identity:17/66 - (25%)
Similarity:24/66 - (36%) Gaps:8/66 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   379 NGLTTEKPTTEASGLCPHDGFSRDGWDCRLYHECRDGERIYYECLEGQYFDENQIVCRPAAEVKC 443
            ||.:.:.|  |..|..||..      ||..|:.|..|..:...|..|..:..:...|.....|.|
  Fly    52 NGPSFDCP--EEFGYYPHPS------DCTQYYVCVFGGALLESCTGGLMYSHDLQTCDWPRNVGC 108

  Fly   444 D 444
            :
  Fly   109 E 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht12NP_726022.1 GH18_chitinase-like 25..375 CDD:299167
Glyco_hydro_18 47..355 CDD:279094
ChtBD2 394..438 CDD:214696 10/43 (23%)
Cda5NP_722590.2 CBM_14 58..106 CDD:279884 13/55 (24%)
CE4_CDA_like_2 1664..1926 CDD:200597
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463825
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.