DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht12 and Cht11

DIOPT Version :9

Sequence 1:NP_726022.1 Gene:Cht12 / 246535 FlyBaseID:FBgn0050293 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_572361.1 Gene:Cht11 / 31630 FlyBaseID:FBgn0029913 Length:432 Species:Drosophila melanogaster


Alignment Length:350 Identity:92/350 - (26%)
Similarity:158/350 - (45%) Gaps:74/350 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 LCTHLVLGSGIGVDGDSGELRITDKI-LLLEKDKLS------SVKTMKWDSIKKVMFTIGGWEED 108
            ||||:.:|.   ...|:..:.:.|.: .:|:.|..|      .|..:.|         ||| .:.
  Fly    90 LCTHINIGP---ATLDNATIVLPDTLRQVLQNDTRSFRAAHPQVHLLLW---------IGG-ADS 141

  Fly   109 SSSFSRMVASPKKRDNFYSSMLEFMFRW-GFDGVQIDWRYPTLLGGHPDDRQNFVILLEELGLIF 172
            ..||:.|||:...|..|..|:.|.:..: ..||:.:||.:|:   .:..:|.:...||.|:...:
  Fly   142 GRSFALMVANHAMRKLFLRSLREILRTYPSLDGIDLDWEFPS---AYDRERMHLSQLLYEIRTEW 203

  Fly   173 RKNQLILMVAVLGRRDNRILE------------SYNIPEIVNHSDFIHLMMHD-----EQDPYHL 220
            |:.          :|.|.||.            :|:|.||..::|:::||.:|     |..|:  
  Fly   204 RRE----------KRTNDILSLAVAAPEGIAFYAYDIREINLYADYVNLMSYDFHFYREDTPF-- 256

  Fly   221 RLAYNAPLVGYEGSVTDSIM----------HWKRNGGAPEKLILGIPLFVRSFTM-DRNQSTVGS 274
             ...||||  |..|...|:|          .|.::|..|::|::|:|.:..|||: :.....:|:
  Fly   257 -TGLNAPL--YARSQERSLMATFNINYTVQWWLKSGLEPQRLVVGLPTYGHSFTLVNPLNHRIGA 318

  Fly   275 ACKGPGRQTKQSHRPGFMTYNEWCVQQSKWSR---MFDQLAKVPYATRGDQWVSYENPRSIWAKM 336
            ...|.|:    ..:.||.|..|.|...:|:.:   .:|..:..||.:...:|:||||..||..|.
  Fly   319 PASGYGK----CGQLGFTTLTETCECVTKFFKPNLSYDAESCSPYLSALQEWISYENQTSIACKA 379

  Fly   337 HLLQEHKLGGAMAWTIDVDDFRGRC 361
            :.::...|||.|.::::.||.:..|
  Fly   380 NYVKSLNLGGVMVFSLNTDDLKNSC 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht12NP_726022.1 GH18_chitinase-like 25..375 CDD:299167 91/349 (26%)
Glyco_hydro_18 47..355 CDD:279094 89/342 (26%)
ChtBD2 394..438 CDD:214696
Cht11NP_572361.1 Glyco_18 68..398 CDD:214753 89/342 (26%)
GH18_chitinase-like 69..428 CDD:299167 91/349 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264489at33208
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 1 1.000 - - otm46727
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.