DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht12 and K08F9.3

DIOPT Version :9

Sequence 1:NP_726022.1 Gene:Cht12 / 246535 FlyBaseID:FBgn0050293 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_001263897.1 Gene:K08F9.3 / 187168 WormBaseID:WBGene00010686 Length:287 Species:Caenorhabditis elegans


Alignment Length:228 Identity:47/228 - (20%)
Similarity:89/228 - (39%) Gaps:58/228 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IMIFLICGCIAKEYNV------FCQYDLGSYY--YKGR----SQFFEWHLDSRLCTHLVLGSGIG 62
            ::||.|...::...:|      .|...|..||  .:||    :||..       .||.|..|...
 Worm    97 VLIFGIYSLVSHSGHVQSTTPDQCDKQLIGYYNGIEGRNILENQFHN-------LTHAVFTSEFV 154

  Fly    63 VDGDSGELRITDKILLLEKDKLSSVKTMKWDSIKKVMFTIGGWEEDSSSFSRMVASPKKRDNFYS 127
            .:..|.|....::..|..:.||.     :.:|..|:|..:|        |::  .|.|     ..
 Worm   155 NENGSFENSHKEQEFLECRKKLG-----ESNSTAKIMIAMG--------FNK--GSCK-----ID 199

  Fly   128 SMLEFMFRWGFDGVQIDWRYPTLLGGHPDDRQNFVILLEELGLIFRKNQLILMVAVLG----RRD 188
            .:..|:.::..|||::.|.:          .::|:..||....:..:.:.|....:||    ...
 Worm   200 CITSFIEKYQVDGVELHWNH----------NEHFLSQLETTRNLKNRLKKISNSKLLGVSASSNW 254

  Fly   189 NRILESYNIPEIVNHSDFIHLMMHD--EQDPYH 219
            :|:.|   :.:::..:||:::.:||  ..|..|
 Worm   255 SRVTE---LDQVLEVADFVNIELHDNLRSDNLH 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht12NP_726022.1 GH18_chitinase-like 25..375 CDD:299167 44/213 (21%)
Glyco_hydro_18 47..355 CDD:279094 35/179 (20%)
ChtBD2 394..438 CDD:214696
K08F9.3NP_001263897.1 Glyco_hydro_18 122..>272 CDD:279094 38/189 (20%)
GH18_chitinase-like 124..276 CDD:299167 38/191 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1289629at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.