DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht12 and chil-7

DIOPT Version :9

Sequence 1:NP_726022.1 Gene:Cht12 / 246535 FlyBaseID:FBgn0050293 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_496131.2 Gene:chil-7 / 182437 WormBaseID:WBGene00007472 Length:482 Species:Caenorhabditis elegans


Alignment Length:314 Identity:70/314 - (22%)
Similarity:124/314 - (39%) Gaps:71/314 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 KVMFTIGGWEEDSSSFSRMVASPKKRDNFYSSMLEFMFRWGFDGVQIDWRYPTLLGGHPDDRQNF 161
            ||||:||| .:::..:|.:||...||..|..|::.|:......||.:.|.:|.:     .:..:|
 Worm   188 KVMFSIGG-HKNAEHYSTVVADSTKRSVFIDSIVSFIKSNNASGVDLFWEWPNI-----SEMNDF 246

  Fly   162 VILLEELGLIFRKNQLILMVAVLGRRDNRILESYNIPE-------------IVNHSDFIHLMMHD 213
            :..::||    ||....|..|  ..:..|.|.|..:|.             ::::.||::::.:.
 Worm   247 ITTIKEL----RKKLAALTKA--QPKGTRYLLSIIVPSSPSDLEYYLRMDGLLHYVDFLNVLTYG 305

  Fly   214 EQDPYH----LRLAYNAPLVGYEGSVTDSIMHW---KRNGGAPEKLILGIPLFVRSF-------- 263
            ...|:.    ..:..||||.|......|..|.:   |..  .|.||.:.:..:.|.:        
 Worm   306 YYAPWSGVNGKFVGPNAPLYGGNRENVDETMQYLICKTR--TPSKLNMALSFYGRYWENVNDNVP 368

  Fly   264 -TMDRNQSTVGSACKGPGRQTKQSHRPGFMTYNE-----WCVQQSKWSRMFDQLAKVPYATRGDQ 322
             .|.:....:....:|.           |:.:..     |...::.|    .:..::||....::
 Worm   369 DEMFKEADLINGKAQGM-----------FVAWKNLAGRGWDKSEALW----HEETQIPYIWNSEE 418

  Fly   323 --WVSYENPRSIWAKMHLLQEHKLGGAMAWTIDVDDFRGRCGEQHGLLRVIFSA 374
              :..:||.||:.|||....:|.:||...|.:..||      ....||.|:.||
 Worm   419 RKFFVFENERSLQAKMDYAADHNIGGVYIWALGADD------NNDTLLNVVSSA 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht12NP_726022.1 GH18_chitinase-like 25..375 CDD:299167 70/314 (22%)
Glyco_hydro_18 47..355 CDD:279094 63/293 (22%)
ChtBD2 394..438 CDD:214696
chil-7NP_496131.2 Glyco_18 127..453 CDD:214753 63/293 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164347
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG28694
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X91
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.