DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht12 and chil-8

DIOPT Version :9

Sequence 1:NP_726022.1 Gene:Cht12 / 246535 FlyBaseID:FBgn0050293 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_001379090.1 Gene:chil-8 / 174541 WormBaseID:WBGene00007473 Length:399 Species:Caenorhabditis elegans


Alignment Length:444 Identity:104/444 - (23%)
Similarity:183/444 - (41%) Gaps:126/444 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YVFMIMIFLICGCIAKEYNVFCQYDLGSYYYKGRSQFFEWHLDSRLCTH--LVLGSGIGVDGDSG 68
            :||.|:.||:.       ::||      |:|.     |...:.|....|  .::|.   |..|.|
 Worm    16 FVFGIVSFLVS-------SLFC------YFYD-----FSNSVQSPSVLHRKRIIGY---VSSDEG 59

  Fly    69 ELRITDK-----------ILLLEKDKLSSVK--------TMKWDSIK-----KVMFTIGGWEEDS 109
            . .||.|           .:|:.||.....|        .||..|::     |||.:|||: |.|
 Worm    60 S-EITIKQLEKLTHVIFAFILVHKDGTIKFKYGTKDGFFDMKRKSMELNRGLKVMVSIGGY-ESS 122

  Fly   110 SSFSRMVASPKKRDNFYSSMLEFMFRWGFDGVQIDWRYPTLLGGHPDDRQNFVILLEELGLIFRK 174
            ..||.::.  ||:....:|:...:.::..|||.|.|.:|::     .|:.|::|.:.||     :
 Worm   123 PLFSDVLV--KKKKKLIASIALLVKKFDLDGVDIFWNWPSI-----TDQSNYLIFIREL-----R 175

  Fly   175 NQLILMVAVLGRRDNRILE------------SYNIPEIVNHSDFIHLMMHD---EQDPYHLRLAY 224
            .:|..:....||.:..::.            .|...||:.:.|||:::..:   |.:    ::..
 Worm   176 KKLTNLKDENGRSNEYVISVIAPSSSSHSEYPYKWTEILENVDFINVITFEYFYEAN----KIGP 236

  Fly   225 NAPLVGYE-GSVTDSIMHWKRNGGAPEKLILGIP---LFVRSFTM---DRNQSTVGSACKGPGRQ 282
            ::||.|.. |:|.|::.:.......|.||.:.:.   ::..:.|:   |:.......:.:||   
 Worm   237 HSPLYGGSFGNVDDTLKYLICRTRTPNKLNMVVSFNGIYWGNTTLPFDDKGVWIPDDSAQGP--- 298

  Fly   283 TKQSHRPGFMTYNEWCVQQSKWSRMFDQ-------LAKVPYATRGD--QWVSYENPRSIWAKMHL 338
                       |:....|.::.|..|||       ..:.||..:.|  |::::||.:|:..||:.
 Worm   299 -----------YSYGWKQFARMSHGFDQNDFEWNEETRTPYIWKADTQQFLTFENEKSLTEKMNY 352

  Fly   339 LQEHKLGGAMAWTIDVDDFRGRCGEQHGLLRVIFSALGDKNGLTTEKPTTEASG 392
            ...|.:||...:|||.||      |::.||.|:          .|..|:.:.||
 Worm   353 AVAHNIGGVAMYTIDDDD------EENTLLNVV----------VTNLPSLKKSG 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht12NP_726022.1 GH18_chitinase-like 25..375 CDD:299167 95/406 (23%)
Glyco_hydro_18 47..355 CDD:279094 84/364 (23%)
ChtBD2 394..438 CDD:214696
chil-8NP_001379090.1 Glyco_18 49..369 CDD:214753 82/354 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164346
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG28694
OrthoDB 1 1.010 - - D1289629at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.760

Return to query results.
Submit another query.