DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht12 and btb-16

DIOPT Version :9

Sequence 1:NP_726022.1 Gene:Cht12 / 246535 FlyBaseID:FBgn0050293 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_494499.2 Gene:btb-16 / 173674 WormBaseID:WBGene00018195 Length:304 Species:Caenorhabditis elegans


Alignment Length:152 Identity:30/152 - (19%)
Similarity:55/152 - (36%) Gaps:43/152 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 DKLSSVKTMKWDSIKKVMF----TIGGWEEDSSSFSRMVASPKKRDNFYSSMLEFMFRWGFDGVQ 142
            ||::....:|:...:...|    |:....|...:.:::|.:|.::     ..:|.|:.:..    
 Worm    70 DKIAGAIDVKFGQNQSQNFTTVRTLVSLTEPCQTLTKVVENPNRQ-----GAVEVMYEYAL---- 125

  Fly   143 IDWRYPTLLGGHPDDRQNFVILLEELGLIFRKNQLILMVAVLGRRD---NRILESYNIPEIVNHS 204
            :.|..|....            .:|:.|...||...|   |:|.|.   |:...||       ||
 Worm   126 VPWITPLQFS------------FDEMFLPSEKNDAFL---VIGERKLHVNKAFLSY-------HS 168

  Fly   205 DFIHLMM-----HDEQDPYHLR 221
            |:...:.     .|:||...|:
 Worm   169 DYFQALFSSNFKEDKQDEIELK 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht12NP_726022.1 GH18_chitinase-like 25..375 CDD:299167 30/152 (20%)
Glyco_hydro_18 47..355 CDD:279094 30/152 (20%)
ChtBD2 394..438 CDD:214696
btb-16NP_494499.2 BTB 147..243 CDD:197585 14/54 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.