DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht12 and btb-17

DIOPT Version :9

Sequence 1:NP_726022.1 Gene:Cht12 / 246535 FlyBaseID:FBgn0050293 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_872000.1 Gene:btb-17 / 173673 WormBaseID:WBGene00018200 Length:321 Species:Caenorhabditis elegans


Alignment Length:171 Identity:31/171 - (18%)
Similarity:55/171 - (32%) Gaps:70/171 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 SFSRMVASPKKRD-----------------NFYSSMLEFMFRWGFDGVQIDWRYPTLLGGHPDDR 158
            ||..|..|.||.|                 :::|.....:|...|                .:|:
 Worm   152 SFDEMFLSSKKNDAVLVIGERKLHVNKAFLSYHSDYFRALFSSNF----------------KEDK 200

  Fly   159 QNFV----ILLEELGL----IFRKNQLILMVAVLGRRDNRILE---SYNIPEIVNHSDFIHLMMH 212
            |:.:    ::.|:.||    |:.|.:.     ...|...:|||   .:.:...::|.:       
 Worm   201 QDEIELKDVVYEDFGLLMTTIYPKTEF-----PSDRTAEKILEMADRFMVQSAIDHVE------- 253

  Fly   213 DEQDPYHLRLAYNAPLVGYEGSVTDSIMHWKRNGGAPEKLI 253
                 |||.         :...:|:..|.|..:....|||:
 Worm   254 -----YHLL---------HNSRITNESMMWMADKYGMEKLM 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht12NP_726022.1 GH18_chitinase-like 25..375 CDD:299167 31/171 (18%)
Glyco_hydro_18 47..355 CDD:279094 31/171 (18%)
ChtBD2 394..438 CDD:214696
btb-17NP_872000.1 BTB 164..260 CDD:197585 19/137 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.