DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht12 and CTBS

DIOPT Version :9

Sequence 1:NP_726022.1 Gene:Cht12 / 246535 FlyBaseID:FBgn0050293 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_004379.1 Gene:CTBS / 1486 HGNCID:2496 Length:385 Species:Homo sapiens


Alignment Length:315 Identity:69/315 - (21%)
Similarity:118/315 - (37%) Gaps:65/315 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 KTMKWDSIKKVMFTIGGWEEDSSSFS---------------RMVASPKKRDNFYSSMLEFMFRWG 137
            |:..|..|..|. |.|.::.:...::               :.:..|..|.::.:..|.......
Human    71 KSYDWSQITTVA-TFGKYDSELMCYAHSKGARVVLKGDVSLKDIIDPAFRASWIAQKLNLAKTQY 134

  Fly   138 FDGVQIDW---------RYPTLLGGHPDDRQNFVILLEELGLIFRK----NQLILMVAVLGRRDN 189
            .||:.||.         .|..|           ..|::|....|.:    :|:...||...:..:
Human   135 MDGINIDIEQEVNCLSPEYDAL-----------TALVKETTDSFHREIEGSQVTFDVAWSPKNID 188

  Fly   190 RILESYNIPEIVNHSDFIHLMMHDEQDPY------HLRLAYNAPLVGYEGSVTDSIMHWKRNGGA 248
            |  ..||...|.:..||:.:|.:|||...      .....||..|.||...:..||        .
Human   189 R--RCYNYTGIADACDFLFVMSYDEQSQIWSECIAAANAPYNQTLTGYNDYIKMSI--------N 243

  Fly   249 PEKLILGIPLFVRSFT-MDRNQSTVGSACKGPGRQTKQSHRPGFMTYNEWCVQQSKWS---RMFD 309
            |:||::|:|.:...:| ::.::..|.:..|.|.|....|...|.....:..::|...|   .::|
Human   244 PKKLVMGVPWYGYDYTCLNLSEDHVCTIAKVPFRGAPCSDAAGRQVPYKTIMKQINSSISGNLWD 308

  Fly   310 QLAKVPYATRGD-----QWVSYENPRSIWAKMHLLQEHKLGGAMAWTIDVDDFRG 359
            :..:.||....|     ..|.|:||:||..|...:|.::|.|...|..:..|:.|
Human   309 KDQRAPYYNYKDPAGHFHQVWYDNPQSISLKATYIQNYRLRGIGMWNANCLDYSG 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht12NP_726022.1 GH18_chitinase-like 25..375 CDD:299167 69/315 (22%)
Glyco_hydro_18 47..355 CDD:279094 67/309 (22%)
ChtBD2 394..438 CDD:214696
CTBSNP_004379.1 GH18_chitobiase 39..378 CDD:119354 69/315 (22%)
Glyco_18 <115..358 CDD:214753 61/263 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.