DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht12 and T19H5.6

DIOPT Version :9

Sequence 1:NP_726022.1 Gene:Cht12 / 246535 FlyBaseID:FBgn0050293 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_001254213.1 Gene:T19H5.6 / 13186491 WormBaseID:WBGene00044807 Length:286 Species:Caenorhabditis elegans


Alignment Length:198 Identity:55/198 - (27%)
Similarity:93/198 - (46%) Gaps:42/198 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 TDKILLL----EKDKLSSVK--TMKWDSIKKVMFTIGGWEEDSSSFSRMVASPKKRDNFYSSMLE 131
            ||..|:.    ::::...:|  |...:|..|:||:||| :::|.:||.:.|||.::.:|.:::||
 Worm   102 TDGTLMFSNQAQRNRFLKLKELTKNENSTVKMMFSIGG-KDNSQNFSPVTASPDRKKSFINAILE 165

  Fly   132 FMFRWGFDGVQIDWRYPTLLGGHPDDRQNFVILLEEL--GLIFRKNQLILMVAVLGRRDNRILES 194
            .:.::..|||.:.||:|     ..||:..:.:.|.||  .|..|:...||.|.|.....||....
 Worm   166 LLEKYDLDGVDLFWRWP-----KSDDKDEYAVFLRELKKQLKARRKDYILSVVVAPLDINRWDSK 225

  Fly   195 YNIPEIVNHSDFIHLMMHDEQDPYHLRLAYNAPLVGYEGSVTDS-----IMHWKRNGGAPEKLIL 254
            ::|.:|:.|:|||                   .:.|...:.|||     ...|    ||....:|
 Worm   226 FDIKKIIKHADFI-------------------SIYGLAKNTTDSESPMFASAW----GAASSSML 267

  Fly   255 GIP 257
            .:|
 Worm   268 ELP 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht12NP_726022.1 GH18_chitinase-like 25..375 CDD:299167 55/198 (28%)
Glyco_hydro_18 47..355 CDD:279094 55/198 (28%)
ChtBD2 394..438 CDD:214696
T19H5.6NP_001254213.1 Glyco_18 69..>255 CDD:214753 50/177 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164359
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1289629at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.