Sequence 1: | NP_726022.1 | Gene: | Cht12 / 246535 | FlyBaseID: | FBgn0050293 | Length: | 470 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001254213.1 | Gene: | T19H5.6 / 13186491 | WormBaseID: | WBGene00044807 | Length: | 286 | Species: | Caenorhabditis elegans |
Alignment Length: | 198 | Identity: | 55/198 - (27%) |
---|---|---|---|
Similarity: | 93/198 - (46%) | Gaps: | 42/198 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 73 TDKILLL----EKDKLSSVK--TMKWDSIKKVMFTIGGWEEDSSSFSRMVASPKKRDNFYSSMLE 131
Fly 132 FMFRWGFDGVQIDWRYPTLLGGHPDDRQNFVILLEEL--GLIFRKNQLILMVAVLGRRDNRILES 194
Fly 195 YNIPEIVNHSDFIHLMMHDEQDPYHLRLAYNAPLVGYEGSVTDS-----IMHWKRNGGAPEKLIL 254
Fly 255 GIP 257 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Cht12 | NP_726022.1 | GH18_chitinase-like | 25..375 | CDD:299167 | 55/198 (28%) |
Glyco_hydro_18 | 47..355 | CDD:279094 | 55/198 (28%) | ||
ChtBD2 | 394..438 | CDD:214696 | |||
T19H5.6 | NP_001254213.1 | Glyco_18 | 69..>255 | CDD:214753 | 50/177 (28%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C160164359 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG3325 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1289629at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.750 |