DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppcdc and Ppcs

DIOPT Version :10

Sequence 1:NP_726105.1 Gene:Ppcdc / 246533 FlyBaseID:FBgn0050290 Length:191 Species:Drosophila melanogaster
Sequence 2:XP_313585.5 Gene:Ppcs / 1274457 VectorBaseID:AGAMI1_013951 Length:316 Species:Anopheles gambiae


Alignment Length:42 Identity:12/42 - (28%)
Similarity:17/42 - (40%) Gaps:11/42 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LIRELSDERLPFKFHLKVLITEAAKHFFELEQIPENVPIYHN 64
            |::|..|.....|.|: ||:|...          ..||:.||
Mosquito    24 LLKEFCDRHYKLKSHI-VLVTSGG----------TTVPLEHN 54

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpcdcNP_726105.1 Flavoprotein 7..187 CDD:450266 12/42 (29%)
PpcsXP_313585.5 None

Return to query results.
Submit another query.