DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppcdc and Ppcs

DIOPT Version :10

Sequence 1:NP_726105.1 Gene:Ppcdc / 246533 FlyBaseID:FBgn0050290 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_080770.2 Gene:Ppcs / 106564 MGIID:1915237 Length:311 Species:Mus musculus


Alignment Length:75 Identity:15/75 - (20%)
Similarity:28/75 - (37%) Gaps:18/75 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 ADLLVIAPLSANSLSKMATGICDNIVMCVVRAWDLEKPLLFAPAMNTRMYDHP--ITREQIDKLT 149
            |..|.::||.::::..:|..:.|..:           |:...|.........|  ||.:.:.|:.
Mouse   161 AAALALSPLGSSAMFYLAAAVSDFYI-----------PVSEMPEHKIHSSGGPLQITMKMVPKML 214

  Fly   150 S-----WGYK 154
            |     |..|
Mouse   215 SPLVKDWAPK 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpcdcNP_726105.1 Flavoprotein 7..187 CDD:450266 15/75 (20%)
PpcsNP_080770.2 PRK05579 <15..273 CDD:235513 15/75 (20%)

Return to query results.
Submit another query.