DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30289 and Sp7

DIOPT Version :9

Sequence 1:NP_726081.1 Gene:CG30289 / 246532 FlyBaseID:FBgn0050289 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_649734.2 Gene:Sp7 / 40918 FlyBaseID:FBgn0037515 Length:391 Species:Drosophila melanogaster


Alignment Length:254 Identity:88/254 - (34%)
Similarity:127/254 - (50%) Gaps:29/254 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 IFGGAKTNIQENPWMVLV-------WSSKPCGGSLIARQFVLTAAHCV--SFED-----LYVRLG 92
            ::.|..|.|.|..||.|:       .....||||||..::||||||||  :.|.     ..||||
  Fly   137 VYNGNDTAIDEFNWMALLEYVDNRGRRELSCGGSLINNRYVLTAAHCVIGAVETEVGHLTTVRLG 201

  Fly    93 DYETLDPMPYCLNNHCIPKFYNISVDMKIVHENYNGITLQ--NDIALLRMSEAVEYSDYVRPICL 155
            :|:|...:. |:::.|......:.::...||..|:.....  :||||||:...|..::|::|:||
  Fly   202 EYDTSKDVD-CIDDICNQPILQLGIEQATVHPQYDPANKNRIHDIALLRLDRPVVLNEYIQPVCL 265

  Fly   156 -LVGEQM--QSIPMFTVTGWGETEYGQFSRILLNATLYNMDISYCNIKF---NKQADRSQICAGS 214
             ||..:|  .:..:..|:|||.|...:.|.|.....|...|..||..||   |.....||:|.|.
  Fly   266 PLVSTRMAINTGELLVVSGWGRTTTARKSTIKQRLDLPVNDHDYCARKFATRNIHLISSQLCVGG 330

  Fly   215 H-TSNTCKGDSGGPLSSKFHYGNRLLSFQYGLVSYGSERCA-ANVAGVYTNVSYHREWI 271
            . ..::|.|||||||..:   |.....:|.|:||:|: ||. ....||||.|:.:.:||
  Fly   331 EFYRDSCDGDSGGPLMRR---GFDQAWYQEGVVSFGN-RCGLEGWPGVYTRVADYMDWI 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30289NP_726081.1 Tryp_SPc 42..271 CDD:214473 86/252 (34%)
Tryp_SPc 42..271 CDD:238113 86/252 (34%)
Sp7NP_649734.2 CLIP 31..84 CDD:288855
Tryp_SPc 136..385 CDD:214473 86/252 (34%)
Tryp_SPc 137..388 CDD:238113 88/254 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.