DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30289 and Pik3ip1

DIOPT Version :10

Sequence 1:NP_726081.1 Gene:CG30289 / 246532 FlyBaseID:FBgn0050289 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001382087.1 Gene:Pik3ip1 / 305472 RGDID:1311203 Length:267 Species:Rattus norvegicus


Alignment Length:34 Identity:9/34 - (26%)
Similarity:13/34 - (38%) Gaps:5/34 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   267 HREWIFNKMVQFKPTGHTTFWLSKLVGQTCNITD 300
            |.:.:..:.:|     ..|..||.....||.|.|
  Rat   208 HEQKVCEREMQ-----RITLPLSAFTNPTCEIMD 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30289NP_726081.1 Tryp_SPc 42..271 CDD:238113 1/3 (33%)
Pik3ip1NP_001382087.1 KR 23..103 CDD:214527
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..122
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.