DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30289 and TMPRSS11E

DIOPT Version :10

Sequence 1:NP_726081.1 Gene:CG30289 / 246532 FlyBaseID:FBgn0050289 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_054777.2 Gene:TMPRSS11E / 28983 HGNCID:24465 Length:423 Species:Homo sapiens


Alignment Length:250 Identity:77/250 - (30%)
Similarity:117/250 - (46%) Gaps:38/250 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 IFGGAKTNIQENPWMV-LVW-SSKPCGGSLIARQFVLTAAHCVSFEDLYVRLGDYETLDPMPYCL 104
            |.||.:....|.||.. |.| .|..||.:||...::::||||.:         .|:  :|..:..
Human   192 IVGGTEVEEGEWPWQASLQWDGSHRCGATLINATWLVSAAHCFT---------TYK--NPARWTA 245

  Fly   105 NNHCIPKFYNISV---DMK------IVHENYNGITLQNDIALLRMSEAVEYSDYVRPICLL-VGE 159
            :       :.:::   .||      ||||.|...:...||:|..:|..|.|::.|..:||. ...
Human   246 S-------FGVTIKPSKMKRGLRRIIVHEKYKHPSHDYDISLAELSSPVPYTNAVHRVCLPDASY 303

  Fly   160 QMQSIPMFTVTGWGETEYGQFSR-ILLNATLYNMDISYCN--IKFNKQADRSQICAGSHTSNT-- 219
            :.|...:..|||:|..:...:|: .|..|.:..:|.:.||  ..:|.......:||||....|  
Human   304 EFQPGDVMFVTGFGALKNDGYSQNHLRQAQVTLIDATTCNEPQAYNDAITPRMLCAGSLEGKTDA 368

  Fly   220 CKGDSGGPLSSKFHYGNRLLSFQYGLVSYGSERCAANVAGVYTNVSYHREWIFNK 274
            |:|||||||.|.   ..|.:.:..|:||:|.|....|..||||.|:..|:||.:|
Human   369 CQGDSGGPLVSS---DARDIWYLAGIVSWGDECAKPNKPGVYTRVTALRDWITSK 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30289NP_726081.1 Tryp_SPc 42..271 CDD:238113 74/245 (30%)
TMPRSS11ENP_054777.2 SEA 51..147 CDD:460188
Tryp_SPc 192..420 CDD:238113 76/248 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.