DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30289 and Prss39

DIOPT Version :10

Sequence 1:NP_726081.1 Gene:CG30289 / 246532 FlyBaseID:FBgn0050289 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_033381.1 Gene:Prss39 / 21755 MGIID:1270856 Length:367 Species:Mus musculus


Alignment Length:176 Identity:41/176 - (23%)
Similarity:67/176 - (38%) Gaps:37/176 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   475 GSVASTEEEEEDDW---ESMYDDNGDCLNPKMLEELTTAVGKVSIETPQS-DYKSYETKQAM--- 532
            ||.|:...|....|   :..||...:....:|.:::.|...:..::|... .:..|:.|:.:   
Mouse   100 GSTANILRELVAQWGITQISYDTEVEPYYTRMDKDIQTVAQENGLQTYTCVSHTLYDVKRIVKAN 164

  Fly   533 -----LNEEEFPHVLEVSSFPAEFKTQDLMMMFSQYKESGFDIKWVDDTHALAVFSSSRIAAEVL 592
                 |..::|.|||.|...| |...:|:.:...|...:..|:..|....:||.. ..::.||||
Mouse   165 GGSPPLTYKKFLHVLSVLGEP-EKPARDVSIEDFQRCVTPVDVDRVYAVPSLADL-GLQVEAEVL 227

  Fly   593 TTGLSFARVKPLGEATAESR--------------SKARKCASSLQP 624
            ..|         ||:.|..|              ||.|...:||.|
Mouse   228 WPG---------GESHALQRLEKHFQSQGWVANFSKPRTIPNSLLP 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30289NP_726081.1 Tryp_SPc 42..271 CDD:238113
Prss39NP_033381.1 Tryp_SPc 68..310 CDD:238113 41/176 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.