DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30289 and Pik3ip1

DIOPT Version :10

Sequence 1:NP_726081.1 Gene:CG30289 / 246532 FlyBaseID:FBgn0050289 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_835362.2 Gene:Pik3ip1 / 216505 MGIID:1917016 Length:264 Species:Mus musculus


Alignment Length:36 Identity:8/36 - (22%)
Similarity:13/36 - (36%) Gaps:9/36 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 CGISKDDPYVPNIFGGAKTNIQENPWMVLVWSSKPC 65
            |.....||..|..:..::|.:.|         .:||
Mouse    70 CRNPDQDPRGPWCYISSETGVPE---------KRPC 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30289NP_726081.1 Tryp_SPc 42..271 CDD:238113 4/24 (17%)
Pik3ip1NP_835362.2 KR 22..102 CDD:238056 8/36 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 94..129 2/3 (67%)

Return to query results.
Submit another query.