DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30288 and CG9733

DIOPT Version :9

Sequence 1:NP_001097398.1 Gene:CG30288 / 246531 FlyBaseID:FBgn0050288 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster


Alignment Length:279 Identity:92/279 - (32%)
Similarity:130/279 - (46%) Gaps:58/279 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 CGTTSSNGYRARIDGGRDAGMESNPWMVRVMI---SGKAV---CGGSLITARFVLTAEHCIS--- 86
            ||..   |.|.||..|:|..:...||||.:..   ||..:   |.||||..|:||||.||::   
  Fly   153 CGGV---GIRNRIYDGQDTDVNEFPWMVLLEYRRRSGNGLSTACAGSLINRRYVLTAAHCLTGRI 214

  Fly    87 ----PMYMNVRLGEYDTRHPIFDC--DDFVCTPRAYNVDVDRKIVH-------SNPGYDIGLLRM 138
                ...::|||||:|||..: ||  ....|:|....:..:...||       ||..:||||:||
  Fly   215 EREVGTLVSVRLGEHDTRTAV-DCPPGGGSCSPEVQRLGFEEIRVHERYSEKASNQVHDIGLIRM 278

  Fly   139 QRSVIFSNYVRPICLILGKTLGGNPLSI--------LRFNFTGWGTNSDGEEQDRLQTATLQQLP 195
            :|:|.:|:.::||||         |.|:        .:|...|||...........|..|:..:.
  Fly   279 ERNVRYSDNIQPICL---------PSSVGLESRQSGQQFTVAGWGRTLKMARSAVKQKVTVNYVD 334

  Fly   196 QWSCERPGRPLDI----SYICA-GSYISDSCKGDSGGPLSAIRTFEGQGRVFQFGVASQGLRLCS 255
            ...|.:....:.:    :.:|| |.:..|||.|||||||   ..|..:..|.: |:.|.|.: | 
  Fly   335 PAKCRQRFSQIKVNLEPTQLCAGGQFRKDSCDGDSGGPL---MRFRDESWVLE-GIVSFGYK-C- 393

  Fly   256 GL----GIYTNVTHFTDWI 270
            ||    |:||||..:..||
  Fly   394 GLKDWPGVYTNVAAYDIWI 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30288NP_001097398.1 Tryp_SPc 42..270 CDD:214473 86/266 (32%)
Tryp_SPc 45..270 CDD:238113 84/263 (32%)
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 86/266 (32%)
Tryp_SPc 162..415 CDD:238113 87/267 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.