DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30288 and CG11836

DIOPT Version :9

Sequence 1:NP_001097398.1 Gene:CG30288 / 246531 FlyBaseID:FBgn0050288 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster


Alignment Length:294 Identity:88/294 - (29%)
Similarity:125/294 - (42%) Gaps:79/294 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 TESGRLLENDCGTTSSNGYRARIDGGRDAGMESNPWMVRVMISGKAVCGGSLITARFVLTAEHCI 85
            ||:..|...||....|| ...||.||:..|:...|||.|::..||..|||||:|..:||:|.||:
  Fly    76 TENSSLKNCDCDCGFSN-EEIRIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHCV 139

  Fly    86 SPM---YMNVRLGEYD-----------------TRHPIFDCDDFVCTPRAYNVDVDRKIVHSNPG 130
            ..:   .:.|..|::|                 .:|..||       |..||             
  Fly   140 KKLRKSKIRVIFGDHDQEITSESQAIQRAVTAVIKHKSFD-------PDTYN------------- 184

  Fly   131 YDIGLLRMQRSVIFSNYVRPICLILGKTLGGNPLSILRFNF---------TGWGTNSDGEEQDRL 186
            .||.|||:::.:.||..::||||         |    |:|:         .|||..|:|.|...:
  Fly   185 NDIALLRLRKPISFSKIIKPICL---------P----RYNYDPAGRIGTVVGWGRTSEGGELPSI 236

  Fly   187 QTATLQQLPQWS---CER---PGRPLDISYICAGSYISDSCKGDSGGPLSAIRTFEGQGRVFQFG 245
            ....  ::|..|   |..   ....:..|.:|||....|||:|||||||    ......:.|..|
  Fly   237 VNQV--KVPIMSITECRNQRYKSTRITSSMLCAGRPSMDSCQGDSGGPL----LLSNGVKYFIVG 295

  Fly   246 VASQGLRLC--SGL-GIYTNVTHFTDWILDVIQN 276
            :.|.|:. |  .|. |:|:.|:.|..||...::|
  Fly   296 IVSWGVG-CGREGYPGVYSRVSKFIPWIKSNLEN 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30288NP_001097398.1 Tryp_SPc 42..270 CDD:214473 78/265 (29%)
Tryp_SPc 45..270 CDD:238113 76/262 (29%)
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 79/267 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.