DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30288 and ea

DIOPT Version :9

Sequence 1:NP_001097398.1 Gene:CG30288 / 246531 FlyBaseID:FBgn0050288 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster


Alignment Length:286 Identity:97/286 - (33%)
Similarity:134/286 - (46%) Gaps:45/286 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LENDCGTTSSNGYRARIDGGRDAGMESNPWMVRVMIS---GKA--VCGGSLITARFVLTAEHCIS 86
            |...||...||    ||.||....::..|||..:..:   ||.  .||||||:.|:|:||.||::
  Fly   116 LPGQCGNILSN----RIYGGMKTKIDEFPWMALIEYTKSQGKKGHHCGGSLISTRYVITASHCVN 176

  Fly    87 PMYM-------NVRLGEYDTR-HPIFDCDDFV-----CTPRAYNVDVDRKIVHSNPGY------- 131
            ...:       .|||||:||. :|  ||:..|     |.|...:|.|:|.|.|  |.|       
  Fly   177 GKALPTDWRLSGVRLGEWDTNTNP--DCEVDVRGMKDCAPPHLDVPVERTIPH--PDYIPASKNQ 237

  Fly   132 --DIGLLRMQRSVIFSNYVRPICLILGKTLGGNPLSILRFNFTGWGTNSDGEEQDRLQTATLQQL 194
              ||.|||:.:.|.::::||||||.|...|.......:..:..|||........:....|.::..
  Fly   238 VNDIALLRLAQQVEYTDFVRPICLPLDVNLRSATFDGITMDVAGWGKTEQLSASNLKLKAAVEGF 302

  Fly   195 PQWSCERPGRPLDI----SYICAGSYIS-DSCKGDSGGPLSAIRTFEGQGRVFQFGVASQGLRLC 254
            ....|:......||    :.:|||.... |||:|||||||..:.|.:.....|..||.|.|...|
  Fly   303 RMDECQNVYSSQDILLEDTQMCAGGKEGVDSCRGDSGGPLIGLDTNKVNTYYFLAGVVSFGPTPC 367

  Fly   255 SGL----GIYTNVTHFTDWILDVIQN 276
             ||    |:||.|..:.|||.:.|::
  Fly   368 -GLAGWPGVYTLVGKYVDWIQNTIES 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30288NP_001097398.1 Tryp_SPc 42..270 CDD:214473 89/263 (34%)
Tryp_SPc 45..270 CDD:238113 87/260 (33%)
eaNP_524362.2 CLIP 37..89 CDD:288855
Tryp_SPc 127..386 CDD:214473 89/263 (34%)
Tryp_SPc 128..389 CDD:238113 90/265 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.