DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30288 and Sp7

DIOPT Version :9

Sequence 1:NP_001097398.1 Gene:CG30288 / 246531 FlyBaseID:FBgn0050288 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_649734.2 Gene:Sp7 / 40918 FlyBaseID:FBgn0037515 Length:391 Species:Drosophila melanogaster


Alignment Length:289 Identity:94/289 - (32%)
Similarity:132/289 - (45%) Gaps:54/289 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 GRLLEN--DCGTTSSNGYRARIDGGRDAGMESNPWMV---------RVMISGKAVCGGSLITARF 77
            |.||.:  .||..|   :..::..|.|..::...||.         |..:|    ||||||..|:
  Fly   119 GNLLPSPPKCGPHS---FSNKVYNGNDTAIDEFNWMALLEYVDNRGRRELS----CGGSLINNRY 176

  Fly    78 VLTAEHCISPM-------YMNVRLGEYDTRHPIFDCDDFVCTPRAYNVDVDRKIVH-------SN 128
            ||||.||:...       ...||||||||...: ||.|.:|......:.:::..||       .|
  Fly   177 VLTAAHCVIGAVETEVGHLTTVRLGEYDTSKDV-DCIDDICNQPILQLGIEQATVHPQYDPANKN 240

  Fly   129 PGYDIGLLRMQRSVIFSNYVRPICLILGKT---LGGNPLSILRFNFTGWGTNSDGEEQDRLQTAT 190
            ..:||.|||:.|.|:.:.|::|:||.|..|   :....|.::    :|||..:...:....|...
  Fly   241 RIHDIALLRLDRPVVLNEYIQPVCLPLVSTRMAINTGELLVV----SGWGRTTTARKSTIKQRLD 301

  Fly   191 LQQLPQWSCERPGRPLDI----SYIC-AGSYISDSCKGDSGGPLSAIRTFEGQGRVFQFGVASQG 250
            |.......|.|.....:|    |.:| .|.:..|||.|||||||.. |.|:...  :|.||.|.|
  Fly   302 LPVNDHDYCARKFATRNIHLISSQLCVGGEFYRDSCDGDSGGPLMR-RGFDQAW--YQEGVVSFG 363

  Fly   251 LRLCSGL----GIYTNVTHFTDWILDVIQ 275
            .| | ||    |:||.|..:.|||::.|:
  Fly   364 NR-C-GLEGWPGVYTRVADYMDWIVETIR 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30288NP_001097398.1 Tryp_SPc 42..270 CDD:214473 85/262 (32%)
Tryp_SPc 45..270 CDD:238113 85/259 (33%)
Sp7NP_649734.2 CLIP 31..84 CDD:288855
Tryp_SPc 136..385 CDD:214473 85/262 (32%)
Tryp_SPc 137..388 CDD:238113 87/264 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.