DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30288 and CG5390

DIOPT Version :10

Sequence 1:NP_001097398.1 Gene:CG30288 / 246531 FlyBaseID:FBgn0050288 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_609374.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster


Alignment Length:283 Identity:82/283 - (28%)
Similarity:124/283 - (43%) Gaps:70/283 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 CGTTSSNGYRARIDG--GRDAGMESNPWMVRVMISGKAV----CGGSLITARFVLTAEHCI---S 86
            ||..:.||...:|.|  .::|.....|||:.::.....:    |||:||....||||.||:   .
  Fly   135 CGYQNPNGVGFKITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNKQ 199

  Fly    87 PMYMNVRLGEYDT-------RHPIFDCDDFVCTPRAYNVDVDRKIVHS---NPG---YDIGLLRM 138
            |..:.||.||:||       ||.    |.:|           ::|::.   |.|   .|:.::.:
  Fly   200 PSSIVVRAGEWDTQTQTEIRRHE----DRYV-----------KEIIYHEQFNKGSLYNDVAVMLL 249

  Fly   139 QRSVIFSNYVRPICLILGKTLGGNPLSILRFNF-----TGWGTN---SDGEEQDRLQTATLQQLP 195
            :........::.:||   ..:|.      :|:|     ||||.|   .|||.|..|:...:..:|
  Fly   250 ESPFTLQENIQTVCL---PNVGD------KFDFDRCYATGWGKNKFGKDGEYQVILKKVDMPVVP 305

  Fly   196 QWSCE------RPGRP--LDISYICA-GSYISDSCKGDSGGPLSAIRTFEGQGRVFQ-FGVASQG 250
            :..||      |.||.  |..|:||| |....|:||||.|.||  :....||...|: .|:.:.|
  Fly   306 EQQCETNLRETRLGRHFILHDSFICAGGEKDKDTCKGDGGSPL--VCPIAGQKNRFKSAGIVAWG 368

  Fly   251 LRLCSGL---GIYTNVTHFTDWI 270
            :. |..:   |:|.:|.....||
  Fly   369 IG-CGEVNIPGVYASVAKLRPWI 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30288NP_001097398.1 Tryp_SPc 45..270 CDD:238113 75/267 (28%)
CG5390NP_609374.1 CLIP_1 64..115 CDD:465709
Tryp_SPc 153..390 CDD:214473 74/263 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.