DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30288 and TMPRSS11A

DIOPT Version :10

Sequence 1:NP_001097398.1 Gene:CG30288 / 246531 FlyBaseID:FBgn0050288 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_872412.3 Gene:TMPRSS11A / 339967 HGNCID:27954 Length:421 Species:Homo sapiens


Alignment Length:114 Identity:29/114 - (25%)
Similarity:43/114 - (37%) Gaps:37/114 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 PAMLRNGTNESTNTTSKGPSKWAAFLTKEENDDPSDALDASESLENVSCTTFDRERIGCPVKQSN 154
            |.:.....:.||:...:..||.|.|   :||.|.:..:    .||     |:: |.|.|..::|.
Human   257 PCLSSMNIDVSTHDAEQNSSKSAKF---QENYDVAGQM----ILE-----TYE-ETIFCQHQESC 308

  Fly   155 AWSNYPS-----------------AQH-DSFDNDAQLALNMDDISPSDF 185
            ...||..                 :|| :||:.|..|.      |.|||
Human   309 EEYNYDPLLLSSLDALGTCEDEKFSQHQESFEEDEDLQ------SFSDF 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30288NP_001097398.1 Tryp_SPc 45..270 CDD:238113 29/114 (25%)
TMPRSS11ANP_872412.3 SEA 49..149 CDD:460188
Tryp_SPc 190..418 CDD:238113 29/114 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.