DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30288 and Pik3ip1

DIOPT Version :10

Sequence 1:NP_001097398.1 Gene:CG30288 / 246531 FlyBaseID:FBgn0050288 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001382087.1 Gene:Pik3ip1 / 305472 RGDID:1311203 Length:267 Species:Rattus norvegicus


Alignment Length:53 Identity:16/53 - (30%)
Similarity:23/53 - (43%) Gaps:12/53 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 MQRSVI-FSNYVRPICLILG-KTLGGNPLSILRFNFTGWGTNSDGEEQDRLQT 188
            |||..: .|.:..|.|.|:. ||:      |:..|    .|.:|.:|...|.|
  Rat   217 MQRITLPLSAFTNPTCEIMDEKTI------IVHSN----QTPADVQEGSTLLT 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30288NP_001097398.1 Tryp_SPc 45..270 CDD:238113 16/53 (30%)
Pik3ip1NP_001382087.1 KR 23..103 CDD:214527
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..122
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.