DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and TMPRSS13

DIOPT Version :10

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001070731.1 Gene:TMPRSS13 / 84000 HGNCID:29808 Length:567 Species:Homo sapiens


Alignment Length:257 Identity:75/257 - (29%)
Similarity:107/257 - (41%) Gaps:47/257 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RVINGKPADLFSNPWMVIIIERGMMKCGGSLITPRYVLTAAHCKSETKSQL----TVRLGDYDVN 101
            |::.|..|.....||.|.:.......|||:||..::|||||||...|:.::    .|..|..:::
Human   325 RIVGGALASDSKWPWQVSLHFGTTHICGGTLIDAQWVLTAAHCFFVTREKVLEGWKVYAGTSNLH 389

  Fly   102 QAVDCSSYGCIPRPREINVTRTYVPSHYTNFRKN-DIALLRLETTVQYGDNIRSICLLMGDYTWS 165
            |.           |...::....:.|:||:...: ||||:||...:....:|...||.|...|:|
Human   390 QL-----------PEAASIAEIIINSNYTDEEDDYDIALMRLSKPLTLSAHIHPACLPMHGQTFS 443

  Fly   166 SNILKNLVKFNT---TGWGRTESRIN--SPVLQQASLTHHHLSYCAQ--VFGKQLDKSHICVASS 223
            .|        .|   ||:|:|....:  ||.|::..:.......|..  |:...|....:|....
Human   444 LN--------ETCWITGFGKTRETDDKTSPFLREVQVNLIDFKKCNDYLVYDSYLTPRMMCAGDL 500

  Fly   224 TG--STCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHCFG------PTVYTNVIHFANWI 277
            .|  .:|||||||||...    ...|..|.||.|:|.    |      |.|||.|.....||
Human   501 RGGRDSCQGDSGGPLVCE----QNNRWYLAGVTSWGT----GCGQRNKPGVYTKVTEVLPWI 554

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 42..280 CDD:238113 74/256 (29%)
TMPRSS13NP_001070731.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..115
PHA03378 <9..148 CDD:223065
13 X 5 AA repeats of A-S-P-A-[GLQR] 9..93
4 X 5 AA repeats of T-P-P-G-R 14..68
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 131..157
SRCR_2 231..321 CDD:464747
Tryp_SPc 325..554 CDD:214473 73/255 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.