DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and TMPRSS5

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_110397.2 Gene:TMPRSS5 / 80975 HGNCID:14908 Length:457 Species:Homo sapiens


Alignment Length:288 Identity:80/288 - (27%)
Similarity:120/288 - (41%) Gaps:50/288 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 FLKVQGQP-------HLLDPQCVTARSEPGLYRVINGKPADLFSNPWMVIIIERGMMKCGGSLIT 73
            ||:...||       .::..:|....:.|...|::.|:.......||...:.......||||::.
Human   185 FLEEAWQPRNNCTSGQVVSLRCSECGARPLASRIVGGQSVAPGRWPWQASVALGFRHTCGGSVLA 249

  Fly    74 PRYVLTAAHCKSETKSQLTVRLGDYDVNQAVDCSSYGCIPRPREINVTRTYVPSHYTNFRKN--- 135
            ||:|:|||||....:   ..||..:.|:..:  .|:..: ||.:..:....:| |.....:|   
Human   250 PRWVVTAAHCMHSFR---LARLSSWRVHAGL--VSHSAV-RPHQGALVERIIP-HPLYSAQNHDY 307

  Fly   136 DIALLRLETTVQYGDNIRSICL-------LMGDYTWSSNILKNLVKFNTTGWGRT--ESRINSPV 191
            |:|||||:|.:.:.|.:.::||       ..|...|.|            |||.|  ....:|.:
Human   308 DVALLRLQTALNFSDTVGAVCLPAKEQHFPKGSRCWVS------------GWGHTHPSHTYSSDM 360

  Fly   192 LQQASLTHHHLSYC--AQVFGKQLDKSHICVASSTG--STCQGDSGGPLTARVRIGSERRVILFG 252
            ||...:.......|  :.|:...|....:|.....|  ..|||||||||..  ..|...|::  |
Human   361 LQDTVVPLFSTQLCNSSCVYSGALTPRMLCAGYLDGRADACQGDSGGPLVC--PDGDTWRLV--G 421

  Fly   253 VVSYGAVHCFGPT---VYTNVIHFANWI 277
            |||:|. .|..|.   ||..|..|.:||
Human   422 VVSWGR-GCAEPNHPGVYAKVAEFLDWI 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 72/254 (28%)
Tryp_SPc 42..280 CDD:238113 73/255 (29%)
TMPRSS5NP_110397.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
SRCR_2 116..213 CDD:292133 5/27 (19%)
Tryp_SPc 217..448 CDD:214473 72/254 (28%)
Tryp_SPc 218..451 CDD:238113 73/255 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.