DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and slc17a7

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001072608.1 Gene:slc17a7 / 780064 XenbaseID:XB-GENE-5742677 Length:576 Species:Xenopus tropicalis


Alignment Length:182 Identity:44/182 - (24%)
Similarity:64/182 - (35%) Gaps:67/182 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 VDCSSYGCIPRPREINVTRTYVPSHYTNFRKNDIALLR-LETTVQYGDNIRSICLLMGDYTWSSN 167
            |||:.:|         :.|.|:           ||::. |...:.:|  ||  |.|       ..
 Frog    52 VDCTCFG---------LPRRYI-----------IAIMSGLGFCISFG--IR--CNL-------GV 85

  Fly   168 ILKNLVKFNTTGWGRTESRINSPVLQQASLTHH-------HLSYCAQVFGKQLDKSHIC------ 219
            .:.::|..||...|      |..|::||..|..       |.|:.......|:...:||      
 Frog    86 AIVSMVNNNTVYKG------NKIVIEQAQFTWDPETVGMIHGSFFWGYIVTQIPGGYICQKFAAN 144

  Fly   220 -------VASSTGSTCQGDSGGPLTARVRIGSERRV-ILFGV---VSYGAVH 260
                   ||:||.:...     |..|||.......| ||.|:   |:|.|.|
 Frog   145 RVFGFAIVATSTLNMLI-----PSAARVHFACVICVRILQGLVEGVTYPACH 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 44/182 (24%)
Tryp_SPc 42..280 CDD:238113 44/182 (24%)
slc17a7NP_001072608.1 2A0114euk 62..503 CDD:129972 39/163 (24%)
MFS 67..490 CDD:119392 36/147 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 517..547
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165162648
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.