DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and mettl7a

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001072195.1 Gene:mettl7a / 779641 XenbaseID:XB-GENE-5802614 Length:245 Species:Xenopus tropicalis


Alignment Length:225 Identity:42/225 - (18%)
Similarity:71/225 - (31%) Gaps:84/225 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VQLLLLIALVFLKVQGQP-HLLDPQCVTARSEPGLYRVINGKPADLFSNPWMVIIIERGMMKCGG 69
            :.||:.|..:.|.:...| |:|        |..|::.||:.|   :|  |:::    ..:||...
 Frog     1 MSLLISILQLCLAILTLPLHIL--------SFLGIWSVISRK---IF--PYIL----APLMKSYN 48

  Fly    70 SLITPRYVLTAAHCKSETKSQLTVRLGDYDVN-QAVDCSSYGCIPRPREINVTRTYVPSHYTNFR 133
            :::            ..||..|...|||:..| :.:.....||               ....||:
 Frog    49 NVM------------DATKKDLFSNLGDFAGNSKEIKLLEIGC---------------GTGANFK 86

  Fly   134 KNDIALLRLETTVQYGDNIRSICLLMGDYTWSSNILKNLVKFNTTGWGRTESRINSPVLQQASLT 198
                         .|.:|.|..||         :|..|..||                |.::...
 Frog    87 -------------FYPNNCRVTCL---------DINPNFEKF----------------LVKSQAE 113

  Fly   199 HHHLSYCAQVFGKQLDKSHICVASSTGSTC 228
            :.||.:...:.....:...:..||.....|
 Frog   114 NSHLKFEGSLVASADNMKQVADASQDVVVC 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 33/189 (17%)
Tryp_SPc 42..280 CDD:238113 33/188 (18%)
mettl7aNP_001072195.1 Methyltransf_11 75..172 CDD:311935 19/122 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.