DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and Prss44

DIOPT Version :10

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_683742.2 Gene:Prss44 / 73336 MGIID:1920586 Length:372 Species:Mus musculus


Alignment Length:261 Identity:78/261 - (29%)
Similarity:110/261 - (42%) Gaps:55/261 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RVINGKPADLFSNPWMVIIIERGMMKCGGSLITPRYVLTAAHCKSETKSQL--TVRLGDYDVNQA 103
            |::.|:||.....||.|.:.......||||||:..:|:|||||   ....|  .|.:||.|:   
Mouse   111 RIVGGRPAPARKWPWQVSLQVHKQHICGGSLISKWWVITAAHC---VYGHLDYAVFMGDADL--- 169

  Fly   104 VDCSSYGCIPRPREINVTRTYVPSHYTNFRK--NDIALLRLETTVQYGDNIRSICL-------LM 159
                   ...||..|.|....|...::..|.  :||||:.|...|.|..||:.:|:       ..
Mouse   170 -------WSKRPVRIPVQDIIVHQDFSMMRTVVHDIALVLLAFPVNYSVNIQPVCIPEKSFLVQP 227

  Fly   160 GDYTWSSNILKNLVKFNTTGWGRT-ESRINSPVLQQASLTHHHLSYCAQVFGKQL--------DK 215
            |...|            .||||:. |...:|.:||:..|.......|.|:. |.:        .:
Mouse   228 GTLCW------------VTGWGKVLEQGRSSRILQEIELNIIRHEKCNQIL-KDIMGNIFTLVQE 279

  Fly   216 SHIC-VASSTGSTCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHC--FG-PTVYTNVIHFANW 276
            ..:| .....|..|||||||||....    .:..:..|:||:| :.|  .| |.|||.|.::.:|
Mouse   280 GGVCGYNEKGGDACQGDSGGPLVCEF----NKTWVQVGIVSWG-LGCGRIGYPGVYTEVSYYRDW 339

  Fly   277 I 277
            |
Mouse   340 I 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 42..280 CDD:238113 77/260 (30%)
Prss44NP_683742.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..72
Tryp_SPc 112..340 CDD:238113 75/258 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.