DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and LOC683849

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_003749780.1 Gene:LOC683849 / 683849 RGDID:1597830 Length:246 Species:Rattus norvegicus


Alignment Length:261 Identity:71/261 - (27%)
Similarity:112/261 - (42%) Gaps:66/261 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RVINGKPADLFSNPWMVIIIERGMMKCGGSLITPRYVLTAAHCKSETKSQLTVRLGDYDVNQAVD 105
            :::.|......|.|:.| .:..|...||||||..::|::||||   .||::.||||::::|    
  Rat    23 KIVGGYTCQENSVPYQV-SLNSGYHFCGGSLINDQWVVSAAHC---YKSRIQVRLGEHNIN---- 79

  Fly   106 CSSYGCIPRPREINVTRTYVPSHYTNFRK---NDIALLRLETTVQYGDNIRSI------------ 155
                  :....|..|....:..|....||   |||.|::|.:.|:....:.::            
  Rat    80 ------VLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQ 138

  Fly   156 CLLMGDYTWSSNILKNLVKFNTTGWGRTE----SRINSPVLQQASLTHHHLSYCAQVFGKQLDKS 216
            ||:.|   |.          ||..:|..|    ..:::|:|.||.        |...:..::..:
  Rat   139 CLISG---WG----------NTLSFGVNEPDLLQCLDAPLLPQAD--------CEASYPGKITDN 182

  Fly   217 HICVASSTG--STCQGDSGGPLTARVRIGSERRVILFGVVS--YGAVHCFGPTVYTNVIHFANWI 277
            .:|.....|  .:||||||||:.....        |.|:||  ||......|.|||.|.::.:||
  Rat   183 MVCAGFLEGGKDSCQGDSGGPVVCNGE--------LQGIVSWGYGCALPDNPGVYTKVCNYVDWI 239

  Fly   278 E 278
            |
  Rat   240 E 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 68/258 (26%)
Tryp_SPc 42..280 CDD:238113 71/260 (27%)
LOC683849XP_003749780.1 Tryp_SPc 23..239 CDD:214473 68/258 (26%)
Tryp_SPc 24..242 CDD:238113 71/260 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.