DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and zgc:123295

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001032651.1 Gene:zgc:123295 / 641564 ZFINID:ZDB-GENE-051127-11 Length:310 Species:Danio rerio


Alignment Length:256 Identity:78/256 - (30%)
Similarity:121/256 - (47%) Gaps:37/256 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RVINGKPADLFSNPWMVIIIE--RGMMKCGGSLITPRYVLTAAHCKSETKSQLTVRLGDYDVNQA 103
            :::.|:.|...|.||.|.:..  .|...||||||...:||:||||..::...:.|:||..     
Zfish    35 KIVGGQNAGAGSWPWQVSLQSPTYGGHFCGGSLINKDWVLSAAHCFQDSIGTIMVKLGLQ----- 94

  Fly   104 VDCSSYGCIPRPREINVTRTYV-----PSHYTNFRKNDIALLRLETTVQYGDNIRSICLLMGDYT 163
               |..|..|    ..:|:|.|     |::......|||||::|:::|.:.|.|..:||.....|
Zfish    95 ---SQSGSNP----YQITKTVVQVINHPNYNNPSNDNDIALVKLDSSVTFNDYIEPVCLAAAGNT 152

  Fly   164 WSSNILKNLVKFNTTGWGRTESRINS--PVLQQASLTHHHLSYCAQVFGKQLDKSHICVA---SS 223
            :::..|..:     ||||:..|..|.  .:||:..:.....|.|.:.:..::..:.||..   ..
Zfish   153 YAAGTLSWV-----TGWGKLSSAANQIPDILQEVEIPIVSHSDCKRAYPGEITSNMICAGLLDQG 212

  Fly   224 TGSTCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHCFG---PTVYTNVIHFANWIELHT 281
            ...:||||||||:.:  |.||:  .|..|:||:|. .|..   |.||..|..:.:||...|
Zfish   213 GKDSCQGDSGGPMVS--RNGSQ--WIQSGIVSFGR-GCAEPGYPGVYARVSQYQDWITSST 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 75/250 (30%)
Tryp_SPc 42..280 CDD:238113 77/252 (31%)
zgc:123295NP_001032651.1 Tryp_SPc 35..264 CDD:214473 75/250 (30%)
Tryp_SPc 36..264 CDD:238113 75/249 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.